KEGG   Robiginitalea biformata: RB2501_04540Help
Entry
RB2501_04540      CDS       T00992                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rbi  Robiginitalea biformata
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:rbi00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rbi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287177..288502
Genome map
AA seq 441 aa AA seqDB search
MITTGDKEYFKNIGKIPFEGKESDNPLAFKYYDENQKVGDKTMKEHFRFAVCYWHTFTGL
GADPFGAPTQQFPWLENSDPVQQAKDKMDAAFEFITKIGAPYYCFHDYDLIAEGPTLAES
ERRLDIITDYAREKMDASGVKLLWGTANCFGNPRYMNGAATNPDFKVLAAAGAQVKNALD
ATIKLDGENYVFWGGREGYMSLLNTDMKREQDHMARFLHMARDYARKQGFKGVFFIEPKP
MEPTKHQYDFDSATVLAFLSKYDLLDDFKLNIEVNHATLAQHTFEHELQVAADNGLLGSI
DANRGDYQNGWDTDQFPVDVYELTQAMLVILEAGGFQGGGVNFDAKIRRNSTDLEDIFYA
HIGGMDAFARALLAAHAVRTQSDFLKMRKDRYASFDSGKGAEFEAGKLSLEDLHKFAGAN
QEIPRTSGRQELYENIINQFI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgattaccaccggagacaaagaatacttcaaaaatatcgggaagatcccattcgaaggc
aaggagtccgacaatcccctggcctttaaatactacgacgaaaaccaaaaagtcggcgac
aagaccatgaaggaacacttccggtttgcggtttgctactggcatacgttcaccgggctc
ggggccgatccattcggggcgcccacccaacaattcccatggctcgaaaattcagacccc
gtgcagcaggccaaggacaaaatggacgcggcctttgagtttatcaccaagattggcgcg
ccctattactgttttcacgactacgacctgatcgccgaggggcccaccctggccgaatcg
gaacgtcgcctggacatcatcacggactacgcccgggaaaagatggacgcctccggggta
aagttgctctggggcactgccaattgcttcggcaacccgcggtacatgaacggggccgcc
acgaacccggatttcaaagtactggccgcagccggggcccaggttaaaaacgccctggac
gccaccatcaaactggatggggaaaattacgtgttctgggggggacgcgaaggctatatg
tccctgctcaatacggacatgaaacgggaacaggaccacatggccaggttcctgcatatg
gcccgcgactatgcccggaagcagggctttaaaggggtcttctttatcgagccgaagccc
atggagcccaccaaacaccagtacgattttgactcagccaccgtcctggcctttttgagc
aagtacgacctgctggacgactttaagctgaatatcgaagtgaaccacgccaccctggcg
cagcacacctttgagcacgaattgcaggtggcagcggacaacggcctgctgggcagtatc
gatgccaatcggggcgattaccagaacggctgggacaccgaccagttcccggtagatgtg
tacgaacttacccaggcgatgctcgtgatcctcgaagccgggggcttccagggaggaggc
gtgaatttcgacgccaagatccgcaggaattccacagacctggaagacatcttctatgcc
cacatcggcgggatggatgcgtttgcaagggcgctgctggccgcgcatgcggtgcggacc
caatcggacttcctgaaaatgcggaaggatcgctacgcgtcctttgacagcgggaagggt
gccgaattcgaagcgggcaaactgtcgctggaggatctccacaaatttgcaggagcgaac
caggagatcccgcggacgagcggccggcaggaactctacgaaaacattatcaaccaattt
atctga

DBGET integrated database retrieval system