KEGG   Robiginitalea biformata: RB2501_04835Help
Entry
RB2501_04835      CDS       T00992                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rbi  Robiginitalea biformata
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RB2501_04835
Enzymes [BR:rbi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RB2501_04835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
344780..346282
Genome map
AA seq 500 aa AA seqDB search
MEEKSNILKYKSLGIYTQNENVVYMREDCHVCISEGFEALTRIRVSNMSSSIIASLHIIT
SEVLRQGEIGLSQIAAKKLKVWDGETLYVSHLEPIESLSFVRAKIYNQKLGYTAYKDIIT
DIIEGDYSNIHLSAFITACAGDRMDIDEISDLTKAMISSGKQLDWKKEIVVDKHCIGGLP
GNRTTPIVVAIAAAYGLTMPKTSSRAITSPAGTADTMEVLTNVTLSGEEIKRVVEQEGGC
LVWGGTAQLSPADDILIKVEKALDIDSEGQLIASVLSKKAAAGATHVVIDIPVGKTAKVR
SEEAVQKLKEHMEAVGNAVGLKIKVVITDGSQPVGRGIGPNLEAVDVLSVLQNKRDAPQD
LKERGLLLAGHLLELSEKVETGKGLDTAKELLESGKAYQKFEAICKAQGRFSKTYVAPYQ
FEMHAPKRGKVKKINNRKIAKLAKLSGAPQSKLAGISMNVRLGDEIEKGGLLYILHAETN
GELNYALEYYENHDDIITIQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaatcaaacatcctcaaatataaatcgctaggtatttacacgcaaaatgaa
aacgttgtgtatatgcgagaagattgtcatgtctgtatttcagaagggtttgaggcattg
acccgtataagggtatcgaacatgagctcctcgataattgcaagtctgcatatcattact
tcagaagttcttaggcagggcgaaatagggctgtcacaaatagcagcaaaaaaactcaaa
gtatgggacggcgaaacgttatacgtgtcccatttggaacccatagaatcattgagcttt
gtaagggcaaaaatttataatcaaaagctcggttatacagcttacaaggacatcatcacg
gatatcatcgaaggcgattattccaatatccacttatcggcatttattacggcctgtgca
ggcgaccgaatggatatcgatgaaatctcggaccttaccaaggcgatgatatcctcggga
aaacaactggattggaagaaggaaatagtggttgacaaacactgtatcgggggattaccg
ggcaatagaactacgcctatcgttgtcgcaattgccgccgcttacgggctgaccatgccc
aaaacttcctcacgggccattacttctccagcgggtacggccgatactatggaagtattg
acgaatgttaccctttctggcgaagaaatcaaacgtgtcgtggaacaggaaggcggctgt
ttggtatggggcggtacggcacaattaagcccagcggacgatattctcattaaggtggaa
aaagccttggatattgatagcgaaggtcaactgattgcctcggtattgtctaaaaaagcg
gctgcaggtgctacccatgtggtaatcgacattcctgttgggaaaacggccaaggtgcgc
agtgaagaggccgtgcaaaaactcaaggaacatatggaagccgtaggcaatgcagtaggg
cttaaaataaaggtggtcattaccgatggcagccagcccgtgggcaggggtatcggccct
aatttagaggcggttgatgtgctaagtgttttgcagaataagagggatgcgccacaagac
ctaaaagaacgaggattattgttggcggggcacctcttggagctatcggaaaaagtggaa
acaggaaaaggccttgatacagcgaaagaattgttggaaagcggaaaggcttatcaaaaa
ttcgaggccatctgcaaggcccaaggaagattttcaaaaacctatgttgccccttaccaa
tttgagatgcatgcacctaaacgtggtaaggtcaaaaaaataaacaatcgaaagattgca
aaactcgcaaaattgtcgggagcaccacaatccaaattggcgggcatttcgatgaacgtc
cggttgggcgatgagatagaaaaggggggattgctctatatactccacgcagaaacaaat
ggggaactgaactatgccttggaatattatgagaatcatgatgatataattacaatccaa
taa

DBGET integrated database retrieval system