KEGG   Robiginitalea biformata: RB2501_05680Help
Entry
RB2501_05680      CDS       T00992                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rbi  Robiginitalea biformata
Pathway
rbi00230  Purine metabolism
rbi01100  Metabolic pathways
Module
rbi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RB2501_05680
Enzymes [BR:rbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RB2501_05680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_22 AAA_16 Herpes_BLRF2 cobW Viral_helicase1 CPT RsgA_GTPase AAA TsaE AAA_19 AAA_23
Motif
Other DBs
NCBI-ProteinID: EAR16364
UniProt: A4CHF6
Position
complement(529977..530627)
Genome map
AA seq 216 aa AA seqDB search
MAGGKLIVFSAPSGSGKTTIVRHLLEQPNLNLAFSVSATSRPRRPKEKHGEHYYFMTVSE
FKQHIKNGDFLEWEEVYRDNFYGTLKSEVERLWAEGKNVIFDIDVAGGLRIKKKFPDQTL
AVFVKPPSVDELKIRLKKRSTESDEKINMRIAKASVELATAPQFDRIIKNYDLEVALKEA
RDLVAGYVGEAEPGENRAKTRDLDAGGNGTDAKNPS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaggaaaactcatcgtattctcagccccgtccggcagcggcaagaccaccatt
gtacgccacctgctggaacagcccaacctgaacctcgccttctcggtttcggccacttcc
cgcccacggcggcccaaggagaaacacggggagcactactatttcatgaccgtgtcggag
tttaaacaacacatcaaaaacggcgatttcctggaatgggaggaggtgtaccgggacaat
ttctacggcaccctaaaaagcgaggtggagcgcctatgggccgaggggaagaacgtgata
ttcgacatcgacgtggccggggggttgcgcatcaagaaaaagttcccggatcagacactg
gctgtatttgtcaagccgcccagtgtggacgagctgaagatccgcctcaagaaaaggagc
acggaaagcgatgagaagatcaatatgcggattgccaaggcatccgtggagctggccacc
gccccccagttcgaccggatcatcaagaactacgacctggaggttgccctgaaggaagcc
cgggacctcgtggccggctatgtcggggaggctgaaccgggagaaaaccgggcgaaaacc
cgcgatttggacgccggcgggaacgggacggatgcaaaaaacccttcctaa

DBGET integrated database retrieval system