KEGG   Robiginitalea biformata: RB2501_08635Help
Entry
RB2501_08635      CDS       T00992                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rbi  Robiginitalea biformata
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RB2501_08635
Enzymes [BR:rbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RB2501_08635
Exosome [BR:rbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RB2501_08635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1181782..1183281)
Genome map
AA seq 499 aa AA seqDB search
MEKYILALDQGTTSCRAIVFNHKGEIVSTAQKEFAQHFPKPGWVEHDAEEIWAVQSGMAS
EALARKGLKPGQIAAIGITNQRETVVIWEKASGKPIHPAIVWQDKRTSDYCDELKAAGHQ
RMVREKTGLVIDSYFSGTKARWILDHVKGARKRAENGELLMGTIDSWLIWNMTGGELHIT
DVTNACRTMLFNIHTMAWDPELTELLGIPEALLPDVRESSEKYGVTDESFLKAGIPISGI
AGDQQAALFGQMCTRKGMVKNTYGTGCFMLMNIGDKPIVSENNLLTSVAWTLNGETTYML
EGSIFIGGAVVQWLRDGLNIIKKSSDVEALATSVPDTGGVYLVPAFAGLGAPHWNQQARG
SIFGLTRGSTDAHVARAALESIAYQTMDILKAMEKDSGIPIRELRVDGGATVNNLMMQFQ
ADVLDAETVRPKIVETTVMGAAFLAGLAVGYWENPRAIQSIWQTDRRFFPTADRAPIEAG
IRGWQRAIRAIEFWSKDNQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatacatcctcgccctggaccagggcaccaccagttgccgcgccatcgttttc
aaccacaaaggagagatcgtttccactgcccagaaggaattcgcccaacatttcccgaaa
ccgggttgggtggaacacgacgcggaggaaatctgggctgtccagtccgggatggcttcg
gaggccctggcccggaaagggctcaagcccggacagattgcggccatcggcatcaccaac
caacgggaaacggtggtgatctgggagaaagccagcggcaaacccatccatccggctatc
gtctggcaggacaagcgcacctcggattactgcgacgaattgaaagccgcaggccaccag
cgtatggtgcgggagaaaaccgggctggtcatcgattcctacttttcaggaaccaaggcg
cgctggattctcgaccatgtaaaaggtgccaggaaacgggcggagaacggggagctgctc
atggggacaatcgactcctggctgatctggaacatgaccgggggcgagttgcatattacc
gacgtcaccaatgcctgccggacgatgctcttcaacatccacaccatggcgtgggacccg
gaactcaccgaattgctcggaatcccggaagccctgctgccggatgtacgcgaatcgagc
gaaaagtacggggtgaccgacgaatccttcctcaaagcaggcatcccgatttccggcatt
gccggcgaccagcaggccgcgcttttcgggcagatgtgtacccgcaaggggatggtcaaa
aacacgtacggcaccgggtgttttatgctgatgaacatcggggacaaacccatcgtttcc
gaaaacaacttattgacctcggtggcctggacgctgaacggggaaaccacctacatgctg
gagggcagcatattcattggcggggccgtggtacaatggcttcgggacgggttgaatatc
attaaaaaatcttcggatgtcgaagcgcttgccaccagcgtaccggatacggggggcgtc
tacctggtcccggcatttgccgggctgggggcaccgcactggaaccagcaggcccgcggt
tcgatttttggccttacccgcgggagtaccgatgcgcatgtggcacgggccgccctggaa
tcgattgcctatcagacgatggatatcctcaaggccatggaaaaggattcggggataccc
attcgggaactgcgggtagacgggggtgccacggtaaacaacctgatgatgcagttccag
gcggacgtgctggatgccgaaacggtccgccccaaaatcgtggaaaccaccgtaatgggt
gccgcgttcctggccgggctggccgtgggctactgggaaaacccccgggccatccagtct
atctggcaaaccgaccgccggtttttccccaccgcagaccgggcacccattgaagccggg
atccgcggatggcaacgcgctattcgcgccattgaattctggtccaaagacaaccaataa

DBGET integrated database retrieval system