KEGG   Robiginitalea biformata: RB2501_09645Help
Entry
RB2501_09645      CDS       T00992                                 

Definition
Dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rbi  Robiginitalea biformata
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RB2501_09645
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB2501_09645
   00020 Citrate cycle (TCA cycle)
    RB2501_09645
   00620 Pyruvate metabolism
    RB2501_09645
Enzymes [BR:rbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RB2501_09645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1418975..1420693
Genome map
AA seq 572 aa AA seqDB search
MAEIIKMPRLSDTMEEGTVAKWLKQVGDKIEEGDILAEIETDKATMEFESFYEGTLLHIG
IEEGDGAPVDALLAIVGEEGEDISGLIDGAGSGDAGAGEDTKETVAEEAATGDGSEDAET
ASGDDAGGQAEVPEGVEIIRMPRLSDTMEEGTVASWIKKKGDAVEEGDILAEIETDKATM
EFESFYSGTLLHIGIEEGESAPVDAVLAVIGPEGTDVEAVLSAGSGSGKPAATEEKGAEA
KKESSEEKAASTDGAAAGREEARSGGSSSGDGRIFISPLARKMAEEKGIDLSDVEGTGDN
GRIVKRDIENYTPSAKPAASVGEGAAKAPAEQAVPASAASMAPAGEESVEEVKNSQMRKV
IAKRLSESKFTAPHYYLTIEVDMSQAMASRARINELPDTKVSFNDMVVKACAMALRKHPQ
VNTTWNGDTTKYNGHVHIGVAVAVEEGLVVPVLKFTDQMSLTAIGASVKDLAGRARNKKL
TPAEMEGSTFTVSNLGMFGIREFTSIINQPNSAILSVGAIVEKPVVRDGQIVVGHTMTIT
LACDHRTVDGATGAQFLQTLRAYLEHPVTMLA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatcataaaaatgccccgactcagcgataccatggaggaaggaaccgtggcg
aaatggctgaaacaggttggagataagatcgaagaaggcgacatccttgcggaaatcgaa
acggacaaagcgaccatggaattcgaatcgttctatgagggtacgctgctccatatcggg
atagaagaaggggacggcgctccggtggatgccctcctggctatagtcggggaagaaggc
gaagacatatcgggcctgatcgacggcgcaggttcgggtgatgccggcgccggcgaggac
acaaaagaaactgtcgcggaggaggctgcaaccggggatggctcggaggatgcagaaact
gcctccggggatgatgccggagggcaggccgaggtccccgagggtgtggaaataatccgc
atgccccgcctgagcgatacgatggaagaaggcacggttgcctcctggatcaagaagaaa
ggggacgcggtggaagaaggagatatcctggccgaaatcgaaacggataaggccaccatg
gaattcgagtccttctattccgggaccctgttgcatatcgggattgaagaaggcgaatcc
gccccggtagatgccgtacttgcggtgatcggacccgagggaacggatgttgaggctgta
ttgtctgccggtagcggatccggcaaaccggctgccacggaagagaaaggggctgaggcc
aaaaaggaaagctccgaggaaaaggcagcatccaccgacggtgcggctgcgggcagggaa
gaagccaggtccggcgggtcatcgtctggtgacggtcggatcttcatttcgcccctggcc
aggaaaatggcagaggaaaagggtatcgacctgagtgacgtggaaggcaccggcgacaac
gggcggatcgtcaagcgggatattgagaattacaccccgtctgccaaaccggcggcaagt
gtgggggaaggcgccgcaaaggctcctgccgagcaggccgttcccgcatctgcggcctcc
atggcccctgccggggaggaatctgtggaagaggtcaagaactcacagatgcgcaaggtc
attgccaaacgcctgagcgaatcgaaatttaccgccccccactactacctgaccatcgag
gtggatatgagccaggccatggcttcccgggcgcggatcaacgaattgccggacaccaag
gtgtcctttaacgatatggtcgtcaaggcctgtgcgatggcactgcggaaacacccccag
gtcaacaccacctggaacggggataccacaaagtacaacggccacgtgcatatcggagtt
gcagtagcggttgaagaaggactggtggtgcccgtcctgaaattcaccgaccagatgagc
ctgaccgccatcggggcatccgtgaaggacctcgccggccgcgcgcgcaacaagaaactc
acccctgcggagatggaggggagtacctttaccgtctccaacctggggatgtttggtatc
cgggaatttacatccatcatcaaccagcccaactcggcgatcctgtctgtaggggccatt
gtggagaaaccggtggtccgggacggccagatcgtcgtcggccatacgatgaccatcacc
ctggcctgcgaccaccgcacggtggacggcgccacaggggcgcaattcctgcaaaccctg
cgggcttacctggagcatcccgtaacgatgctggcctaa

DBGET integrated database retrieval system