KEGG   Robiginitalea biformata: RB2501_10397Help
Entry
RB2501_10397      CDS       T00992                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
rbi  Robiginitalea biformata
Pathway
rbi00010  Glycolysis / Gluconeogenesis
rbi00520  Amino sugar and nucleotide sugar metabolism
rbi01100  Metabolic pathways
rbi01110  Biosynthesis of secondary metabolites
rbi01120  Microbial metabolism in diverse environments
rbi01130  Biosynthesis of antibiotics
rbi01200  Carbon metabolism
Module
rbi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB2501_10397
   00520 Amino sugar and nucleotide sugar metabolism
    RB2501_10397
Enzymes [BR:rbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     RB2501_10397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: EAR14728
UniProt: A4CM36
Position
complement(1558866..1559624)
Genome map
AA seq 252 aa AA seqDB search
MEVLGIDVGGSGIKGAMVHMETGEMLTERFRIPTPKSRKPDEMAEVIAKIVKHFDYKGPV
GCGFPSVIKKGICKSKGNLHKSWKGMDVEALFEKATGMDFTVINDADAAGYAMMNYGIGK
DMQGFVVMITIGTGLGSGAFLDGRLIPNFELGQIPYKKYDKIESWAAASAKEREGLSYKK
WGKRFNKFLKYVELIVAPDTIVLGGGTSKDFDQYKKYITVDTPVIPAGLQNHAGIIGAAT
ACLVCHPELNEG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggaagtactcggaatagatgtgggcggctcgggaatcaagggcgccatggtccacatg
gaaaccggtgaaatgcttacggagcgattccgcatccccacgcccaaatccaggaaaccc
gacgagatggccgaggtgatcgcgaaaatcgtgaaacacttcgactacaagggccctgtg
ggctgcggcttcccctcggtaatcaagaaagggatctgcaagtccaagggcaacctgcac
aaatcctggaagggcatggacgtggaagccctgttcgaaaaagccaccggcatggatttc
accgttatcaacgacgcggatgctgccggatacgccatgatgaactacgggatcggcaag
gatatgcagggttttgtggtgatgattaccatcgggaccggcctgggcagcggggccttc
ctggacggacggctgatcccgaactttgagctcgggcagatcccctataagaaatacgac
aaaatcgaatcctgggcagcggcttccgccaaggaacgggagggcctcagctataaaaaa
tggggcaaacgattcaataaattcctgaaatacgtggaactcatcgtggccccggacacg
attgtcctcggcgggggaacctccaaagacttcgaccagtacaagaaatatattacggtg
gatacgcccgtaataccggcagggctacagaaccacgcgggcattatcggcgcagctacc
gcctgcctggtctgccacccggaactcaacgaaggctag

DBGET integrated database retrieval system