KEGG   Robiginitalea biformata: RB2501_10447Help
Entry
RB2501_10447      CDS       T00992                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rbi  Robiginitalea biformata
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rbi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1573003..1574673
Genome map
AA seq 556 aa AA seqDB search
MCGIVCAFDLKQPAEDLRPQMLEMSRVLRHRGPDWNGIHMSDTAILAHERLAIVDPASGK
QPLYSPDGNLVLAANGEIYNHQSLRKRFEGTYDFRTESDCEVILALYQEQGPAFLDELNG
IFGFALYDSQADRYFIARDHMGIIPLYIGWDRHGTFYVASELKALEGTCTRIELFPPGHY
MLSDQEGFQRWYSRDWMEYDAVEDNPTDIAALRKALEDAVHRQLMSDVPYGVLLSGGLDS
SVTSAIAKKYAQKRVESGDQADAWWPQLHSFSVGLEGSPDLAAARKVADHIGTVHHEIKF
TIQEGLDAVRDVIYHLETYDITTVRASTPMYLMARVIKSMGIKMVLSGEGADELFGGYLY
FHKAPGPRDFHEETVRKLDKLHMYDCLRANKSLAAWGIEGRVPFLDKEFMDVAMRLNPRD
KMITPERMEKWVVRKAFEDYLPESVAWRQKEQFSDGVGYSWIDTLKEVVAEAVSDEQLAN
AHFRFPIQTPTSKEEYYYRSIFESHFPSDAAAESVPQEPSVACSTRIALEWDEAFRNMND
PSGRAVARVHADAYEK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgtatgtgccttcgatttgaaacaaccggccgaggatttacggccccag
atgctggaaatgtcccgggtcctgagacacagggggccggactggaatggcatccacatg
tcggatacggccatcctggcccatgagcgcctggccatcgtagacccggcatccgggaaa
caaccgctttacagcccggacggcaacctggtcctggctgcaaacggagaaatctacaac
caccaatcccttcgcaaacgctttgaagggacctacgacttccgcaccgaatccgattgc
gaggttatcctggccctctaccaggagcagggcccggccttcctggatgaactcaacggg
atttttggctttgccctctacgacagccaggcggaccggtatttcatcgcccgggaccat
atgggtattatcccgctgtatattggctgggaccggcacggcaccttttatgtggcctct
gaactaaaggcgctggagggtacctgtacgcgcattgagctatttccgcccggccactac
atgctgagcgaccaggaagggtttcagcgctggtacagccgcgattggatggagtatgac
gcagtagaggataaccccacggatatcgctgccctgcgcaaggcactggaggacgcggtc
caccggcagctgatgtccgacgtaccctacggggtgctgctttcaggaggcctggactcc
tcggttacctcggctatcgcaaagaaatatgcccagaagcgggtggagtccggcgaccag
gccgatgcctggtggccgcagctgcactccttctccgtcgggctggaaggctccccggac
ctggcggctgcccgcaaagtggccgaccatatcgggacggtccaccacgagataaaattt
accatacaggaagggctggacgccgtgcgggacgtgatttaccacctggagacttacgac
atcaccacggtacgggcatccacgcctatgtatctgatggcccgggtgatcaaatcgatg
gggatcaagatggtgttgtcgggcgaaggggccgacgagctatttggcggatacctgtac
ttccacaaggctcccgggccgcgggatttccacgaggaaaccgtccggaaactcgacaag
ctccacatgtacgattgcctgcgcgccaacaaatccctggcggcctgggggatcgagggg
cgcgtgcccttcctcgacaaggagtttatggatgtggccatgcgcctgaatccgcgggat
aaaatgatcaccccggagcgaatggaaaaatgggtggtgcgcaaggcctttgaagactac
ctgcccgaaagcgtggcctggcggcaaaaggagcagttctcggatggggtgggctacagc
tggatcgatacgcttaaggaagtggtcgcggaggctgtcagcgacgaacaattggccaat
gcccatttccgattcccgattcagaccccgacctccaaggaggagtattattaccggagc
atctttgaatcgcatttcccgagcgatgcggccgcggaaagcgtgcctcaggagccttct
gtagcctgcagtacgcggattgcgctggaatgggacgaggcgttccgcaacatgaacgac
ccttccggccgggccgttgccagggtccacgcggacgcctatgaaaagtag

DBGET integrated database retrieval system