KEGG   Robiginitalea biformata: RB2501_10602Help
Entry
RB2501_10602      CDS       T00992                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rbi  Robiginitalea biformata
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rbi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1607878..1608708)
Genome map
AA seq 276 aa AA seqDB search
MTICCNGKLLDLSTPRIMGILNSTPDSFYDGGRFADPRAAMLRAEQLLGEGADFLDVGGY
STRPGAGQVSESEELGRVVPLVEKLAREFPEARISVDTFRSRVARETLGAGAALINDITA
GEADPKMLPLLAEKQVPVILMHMRGTPATMSGLTDYDHLVTEVLEYLSGRLLAARELGIV
DVLADPGFGFAKTREQNFELLGKLRHFGVLDVPILVGLSRKSMIWKTLGITPDEALNGTT
ALHMAALFGGASILRVHDAAAARECIHLWQAIGSPQ
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaccatctgctgcaatggaaagctgctggatctttcgaccccgcggattatgggcatc
ctcaattcaaccccggattcgttttacgacggcggacgatttgcagacccacgggcagcc
atgctccgggcagaacaactgctgggcgaaggtgccgacttcctggacgtgggcggttac
agcacgcgtcccggagcggggcaggtcagtgagagcgaagaactcgggcgcgtggtcccg
ctggtggaaaagctggcccgggaattcccggaggcgcggatttcggtggatacattccgg
agccgggtagcccgggaaaccctcggggcgggggcggccctgatcaacgacataaccgcc
ggggaggcagacccgaagatgctgccgctgctcgctgaaaaacaggtgcctgtgatcctg
atgcacatgcggggtaccccggccaccatgtccgggctcaccgactacgaccatttggtg
acggaggtgctcgaatacctttccggccggctgctggccgccagggaactgggaattgtc
gatgtcctcgcagacccgggcttcggcttcgccaagacccgggaacagaattttgaactc
cttggcaaactgcggcatttcggggtgttggacgtcccgatcctggtggggctcagccgg
aagtccatgatatggaaaaccctggggattaccccggacgaggccctgaacggcactacc
gccctgcatatggcagccctttttgggggtgcttccatcctgcgcgtgcacgacgcggct
gccgccagggagtgcatccacctctggcaggcaatcgggagcccgcaatag

DBGET integrated database retrieval system