KEGG   Robiginitalea biformata: RB2501_10602Help
Entry
RB2501_10602      CDS       T00992                                 

Definition
(GenBank) putative dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
rbi  Robiginitalea biformata
Pathway
rbi00790  Folate biosynthesis
rbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RB2501_10602
Enzymes [BR:rbi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RB2501_10602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: EAR14769
UniProt: A4CM77
Position
complement(1607878..1608708)
Genome map
AA seq 276 aa AA seqDB search
MTICCNGKLLDLSTPRIMGILNSTPDSFYDGGRFADPRAAMLRAEQLLGEGADFLDVGGY
STRPGAGQVSESEELGRVVPLVEKLAREFPEARISVDTFRSRVARETLGAGAALINDITA
GEADPKMLPLLAEKQVPVILMHMRGTPATMSGLTDYDHLVTEVLEYLSGRLLAARELGIV
DVLADPGFGFAKTREQNFELLGKLRHFGVLDVPILVGLSRKSMIWKTLGITPDEALNGTT
ALHMAALFGGASILRVHDAAAARECIHLWQAIGSPQ
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaccatctgctgcaatggaaagctgctggatctttcgaccccgcggattatgggcatc
ctcaattcaaccccggattcgttttacgacggcggacgatttgcagacccacgggcagcc
atgctccgggcagaacaactgctgggcgaaggtgccgacttcctggacgtgggcggttac
agcacgcgtcccggagcggggcaggtcagtgagagcgaagaactcgggcgcgtggtcccg
ctggtggaaaagctggcccgggaattcccggaggcgcggatttcggtggatacattccgg
agccgggtagcccgggaaaccctcggggcgggggcggccctgatcaacgacataaccgcc
ggggaggcagacccgaagatgctgccgctgctcgctgaaaaacaggtgcctgtgatcctg
atgcacatgcggggtaccccggccaccatgtccgggctcaccgactacgaccatttggtg
acggaggtgctcgaatacctttccggccggctgctggccgccagggaactgggaattgtc
gatgtcctcgcagacccgggcttcggcttcgccaagacccgggaacagaattttgaactc
cttggcaaactgcggcatttcggggtgttggacgtcccgatcctggtggggctcagccgg
aagtccatgatatggaaaaccctggggattaccccggacgaggccctgaacggcactacc
gccctgcatatggcagccctttttgggggtgcttccatcctgcgcgtgcacgacgcggct
gccgccagggagtgcatccacctctggcaggcaatcgggagcccgcaatag

DBGET integrated database retrieval system