KEGG   Robiginitalea biformata: RB2501_10617Help
Entry
RB2501_10617      CDS       T00992                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rbi  Robiginitalea biformata
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:rbi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rbi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rbi00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rbi00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1611103..1611822
Genome map
AA seq 239 aa AA seqDB search
MNKTASESEALLDELAAKLPDCSAEVMVAPVFVNLAEAVRRLEHSKIEAIAQNMHFADSG
AYTGEVAADMLLGIGVDTVILGHSERRAYFGEDDDLLAKKVGQAIEKGMRTIFCFGEELK
DRQAGKHFEVVESQLKNALFQLPEEAWGRIVLAYEPVWAIGTGETASPEQAQEMHAFIRK
IVSDAYTDAVAQKVSILYGGSVKPGNAAEIFSKPDVDGGLIGGASLKADDFVAIIKAIG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacggcctccgagtcggaagccctgctggacgaactggccgccaagctgccg
gactgttcggcggaggtgatggtcgcgcccgtattcgtcaacctggccgaagcggtcagg
cgcctggaacattctaaaatcgaggcgattgcccagaacatgcactttgcggattccggg
gcctacaccggggaagttgccgcggatatgctgctcggcatcggggtagatacggtcatc
ctcgggcattccgagcggcgggcgtattttggcgaggacgacgacttgctagccaaaaaa
gtggggcaggccattgaaaaaggcatgcggaccatcttctgctttggggaagagctcaag
gaccggcaagccgggaagcatttcgaagtggtagaatcccagttgaagaacgccctgttc
cagctgccggaggaagcctgggggcggatcgtcctggcgtatgagcccgtctgggctatc
ggcacgggagaaaccgccagcccggaacaggcccaggagatgcatgcatttatccgtaaa
attgtgtccgacgcctacacggatgcggtggcccagaaagtttccatcctttatggcggc
agcgtcaagcccgggaacgccgccgagatcttttccaagcccgatgtagatggcgggctg
atcggcggggcctccctcaaggcggatgactttgtggccattatcaaggccatcggatag

DBGET integrated database retrieval system