KEGG   Robiginitalea biformata: RB2501_10617Help
Entry
RB2501_10617      CDS       T00992                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rbi  Robiginitalea biformata
Pathway
rbi00010  Glycolysis / Gluconeogenesis
rbi00051  Fructose and mannose metabolism
rbi01100  Metabolic pathways
rbi01110  Biosynthesis of secondary metabolites
rbi01120  Microbial metabolism in diverse environments
rbi01130  Biosynthesis of antibiotics
rbi01200  Carbon metabolism
rbi01230  Biosynthesis of amino acids
Module
rbi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rbi_M00002  Glycolysis, core module involving three-carbon compounds
rbi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB2501_10617
   00051 Fructose and mannose metabolism
    RB2501_10617
   00562 Inositol phosphate metabolism
    RB2501_10617
Enzymes [BR:rbi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RB2501_10617
Exosome [BR:rbi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RB2501_10617
  Exosomal proteins of bladder cancer cells
   RB2501_10617
  Exosomal proteins of melanoma cells
   RB2501_10617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: EAR14772
UniProt: A4CM80
Position
1611103..1611822
Genome map
AA seq 239 aa AA seqDB search
MNKTASESEALLDELAAKLPDCSAEVMVAPVFVNLAEAVRRLEHSKIEAIAQNMHFADSG
AYTGEVAADMLLGIGVDTVILGHSERRAYFGEDDDLLAKKVGQAIEKGMRTIFCFGEELK
DRQAGKHFEVVESQLKNALFQLPEEAWGRIVLAYEPVWAIGTGETASPEQAQEMHAFIRK
IVSDAYTDAVAQKVSILYGGSVKPGNAAEIFSKPDVDGGLIGGASLKADDFVAIIKAIG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacggcctccgagtcggaagccctgctggacgaactggccgccaagctgccg
gactgttcggcggaggtgatggtcgcgcccgtattcgtcaacctggccgaagcggtcagg
cgcctggaacattctaaaatcgaggcgattgcccagaacatgcactttgcggattccggg
gcctacaccggggaagttgccgcggatatgctgctcggcatcggggtagatacggtcatc
ctcgggcattccgagcggcgggcgtattttggcgaggacgacgacttgctagccaaaaaa
gtggggcaggccattgaaaaaggcatgcggaccatcttctgctttggggaagagctcaag
gaccggcaagccgggaagcatttcgaagtggtagaatcccagttgaagaacgccctgttc
cagctgccggaggaagcctgggggcggatcgtcctggcgtatgagcccgtctgggctatc
ggcacgggagaaaccgccagcccggaacaggcccaggagatgcatgcatttatccgtaaa
attgtgtccgacgcctacacggatgcggtggcccagaaagtttccatcctttatggcggc
agcgtcaagcccgggaacgccgccgagatcttttccaagcccgatgtagatggcgggctg
atcggcggggcctccctcaaggcggatgactttgtggccattatcaaggccatcggatag

DBGET integrated database retrieval system