KEGG   Robiginitalea biformata: RB2501_11377Help
Entry
RB2501_11377      CDS       T00992                                 

Definition
(GenBank) Succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rbi  Robiginitalea biformata
Pathway
rbi00020  Citrate cycle (TCA cycle)
rbi00640  Propanoate metabolism
rbi00660  C5-Branched dibasic acid metabolism
rbi01100  Metabolic pathways
rbi01110  Biosynthesis of secondary metabolites
rbi01120  Microbial metabolism in diverse environments
rbi01130  Biosynthesis of antibiotics
rbi01200  Carbon metabolism
Module
rbi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rbi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RB2501_11377
   00640 Propanoate metabolism
    RB2501_11377
   00660 C5-Branched dibasic acid metabolism
    RB2501_11377
Enzymes [BR:rbi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RB2501_11377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: EAR14924
UniProt: A4CMN2
Position
1768869..1770062
Genome map
AA seq 397 aa AA seqDB search
MNLHEYQGKEILASFGVRIQRGIVAHNKKEAVDAAKQLTQETGTSWHVIKAQVHAGGRGK
GGGVKLAKNLKEVESIAEEIIGMNLVTPQTSAEGKKVHQVLVAEDVYYPGDSDTEEYYMS
VLLNRAESRVMIMYSPEGGMDIEEVADKTPHLIFTEEIDPATGLLPFQARKIAFNLGLSG
TAFKEMTRFVSSLYKAYEQSDASLFEINPVLKTSDDKILAVDAKVSLDDNALFRRKQYAE
MRDLREENPIEVEARAVGLNYVDLDGNVGCMVNGAGLAMATMDLIKMAGGEPANFLDVGG
TADAKRVEEAFRIILKDANVKAILINIFGGIVRCDRVAQGVVDAYKNMGDAIKVPIIVRL
QGTNAELAKEILDNSGLAVHSAVQFQEAADKVKEVLA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaataccaaggaaaagagattctggcgagtttcggcgtccgcatccag
cgcggcatcgtggcccataacaagaaggaagccgtggatgctgccaagcagctcacacag
gaaaccggcacgagctggcatgtcatcaaggctcaggtccacgccgggggccgtggcaag
ggcggcggggtgaaactggccaaaaacctgaaagaggtggaatccatcgccgaggagatc
atcgggatgaatttggtaaccccccagacatctgccgaaggtaaaaaagtgcaccaggta
ctggttgcggaagacgtctactacccgggagacagcgacacggaggaatactacatgtcc
gtactactcaaccgggcggaatcgcgtgtgatgatcatgtattcccccgaaggcgggatg
gatatcgaggaggtagccgataagaccccccacctgatcttcaccgaagagatagacccg
gctaccggcctgctgccgttccaggcccgcaaaatcgcatttaacctggggctttcgggt
acggctttcaaggaaatgacacgatttgtaagctccctctacaaggcgtatgagcaaagc
gatgcgagcttgtttgaaatcaacccggtactgaagacctcggatgataaaatcctggct
gtggatgccaaggtgtccctggacgacaatgcgctcttccgccgcaagcagtatgcggaa
atgcgggacctgagggaagagaaccccatcgaggtggaggcgcgtgccgtgggcctgaat
tacgtggacctggacgggaatgtcggttgcatggtgaacggggccggattggccatggca
accatggacctgatcaagatggccggtggcgaacctgctaattttctggacgtcggaggg
acggccgatgcaaaacgcgtggaggaagccttccggatcatcctcaaggacgccaacgtc
aaagccatccttatcaacattttcggagggatcgtccgctgcgaccgggtggcccagggt
gtcgtggatgcctataagaatatgggagacgccataaaggtgccgatcatcgtgcgcctg
cagggcaccaacgccgaactcgccaaggagatcctggataattccgggttggcggtacac
tccgcagttcagttccaggaagccgcggacaaggtgaaggaagtgcttgcctga

DBGET integrated database retrieval system