KEGG   Robiginitalea biformata: RB2501_11577Help
Entry
RB2501_11577      CDS       T00992                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
rbi  Robiginitalea biformata
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB2501_11577
   00052 Galactose metabolism
    RB2501_11577
Enzymes [BR:rbi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     RB2501_11577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1809454..1810359)
Genome map
AA seq 301 aa AA seqDB search
MEQVTVKNDHLCLGVLNYGAIIQRLQFRDARGRFTDVVVGRDAPEDYLDDPAFLGACVGR
FAGRISGGRLRIGNEYHPIPHRDGITLHGGERGFGKRYWTIESHSGDGDTAEVQLAYTSP
HGEEGFPGELRTRLIYRLTGKTLMVRHEAETDRPTVVNLTNHSYFKLDDSDSIDHYRLRL
GSGKRLETDERLLPTGRILEVAGSLYDFIQEREIGEIRLDTPYVLDPDGPAAVLYSRESG
IRMEVSTNQPALVVYTPPHFAGICFETQGYPDAPNFSDFPGCELHPGQVYRNETLFSFEN
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttggaacaagttactgtaaaaaacgaccacctgtgcctcggggttttgaattacggggcc
atcatccaacgcctgcaattccgggatgcccggggccgattcaccgatgtagtggtgggc
agggacgccccggaagactacctggatgaccccgccttcctcggggcctgcgtggggcgt
tttgccgggcggatctccggcggccggctgcgaatcggaaacgaataccacccgatcccc
caccgggacggcatcaccctccacgggggagaacgcggattcggcaagcggtactggacc
atcgaatcccattcgggcgacggggacacggcggaagtacaactggcatataccagcccg
cacggcgaagagggatttccgggcgaattgcgaacccggttgatttaccggctcaccggg
aaaaccctcatggtaaggcacgaggccgaaacggaccggcccacggtggtcaacctgacg
aaccattcgtattttaagctggatgactctgattccatcgaccactaccggctgcgcctc
gggtccggcaagcgcctggaaaccgatgagcgcctgttgcccacagggcgcatcctggaa
gttgccggcagcctctacgacttcattcaggagcgggaaatcggcgagatacggctcgac
acgccctatgtactggatccggacgggcctgccgcagtcctgtattcccgggaatccggg
attcggatggaggtcagcaccaaccaaccggccctggtggtttacaccccaccccatttc
gcgggtatttgctttgagacccaggggtatccggatgccccgaacttcagcgatttcccg
ggttgcgaattgcatcctggacaggtatacaggaatgaaacccttttttcctttgagaat
ttctga

DBGET integrated database retrieval system