KEGG   Robiginitalea biformata: RB2501_11617Help
Entry
RB2501_11617      CDS       T00992                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rbi  Robiginitalea biformata
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RB2501_11617
Enzymes [BR:rbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RB2501_11617
   3.1.2  Thioester hydrolases
    3.1.2.-  
     RB2501_11617
Lipid biosynthesis proteins [BR:rbi01004]
 Fatty acid synthase
  Component type
   RB2501_11617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1815664..1816422)
Genome map
AA seq 252 aa AA seqDB search
MSGLLKFRYILFLFLLVACKGEPSEKQAEELPENAASEEEAPGESSGNTILFFGDSLTAG
LGLEPEQAFPALIGERLDSLGYDYQVVNAGLSGETTASGANRLDWVLRQPVAVFVLELGA
NDGLRGIPLSETRKNLKDIVERVRESDSTTRILLAGMQLPPNMGPAYTTEFREIFPELAA
QHNLHLIPFLLDGVGGIPELNQQDGIHPTAEGHRILADNVWEVLGPVLQAEALQAGQPGG
DQTPGTASDTRP
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtccggactcttaaagtttcgttatattttattccttttcctgctggtagcctgcaaa
ggcgaaccatccgaaaaacaagctgaagagcttccagaaaacgcggcttccgaggaagag
gctcccggggaaagttccgggaatacgattcttttcttcggggattcccttaccgccggc
ctgggcctggagcccgagcaggctttcccggcactaatcggagaacgcctcgattccctg
gggtacgactaccaggtagtcaatgccggcctcagcggggaaactacggcaagcggggcc
aaccggctggactgggtactccggcaaccggtagctgtatttgtactggaactcggcgcc
aacgacgggctccgcggcatccccctttccgaaacgcgaaaaaacctgaaggatattgtg
gaacgcgtccgcgaatcggattctaccacccgcatccttttggccggcatgcaactgcca
cccaacatggggccggcctacaccacggaattccgtgaaattttcccggagctggccgcc
caacacaacttgcacctcatcccctttttactggacggcgtggggggtatccccgaactc
aaccaacaggacggcatccaccctacggccgaaggccacaggatactcgcggacaatgtc
tgggaagtcctggggccggtattgcaggcggaagctttgcaggcggggcagcccgggggg
gatcaaactccgggtacggccagtgataccaggccttga

DBGET integrated database retrieval system