KEGG   Robiginitalea biformata: RB2501_12682Help
Entry
RB2501_12682      CDS       T00992                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rbi  Robiginitalea biformata
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RB2501_12682
Enzymes [BR:rbi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RB2501_12682
Exosome [BR:rbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RB2501_12682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2034729..2036624
Genome map
AA seq 631 aa AA seqDB search
MGKVIPHSFFTEFDINLFKSGKHYRLYEKMGSHLTEVDGEKGVYFAVWAPSAKSVSVVGD
FNYWLEGEHPLNVRWDESGIWEGFIPGLDQGTLYKYKIHSHVNDVKTEKADPFARYSEHP
PKTASVVWADDHKWKDGTWMKNRAGHNGLDKPYSVYEVHLGSWRRNADNEFLTYLELADQ
LVEYVKEMNFTHVEFMPVMEFPYDPSWGYQLTGYFAPTSRFGKPEDFKVLVDALHRAGIG
VILDWVPSHFPEDAHGLGNFDGSHLYEHPDRRKGYHPDWKSLIFNYGRNEVRAFLISNAL
YWLDHFHVDGLRVDAVASMLYLDYSREEGEWEPNMYGNNEHLEAISFIRELNAQVYGNYP
GVQTIAEESTAFSKVTKPVDVGGLGFGMKWMMGWMHDTLEYFKKEPVYRKHHQNDITFSM
TYAFTENFMLPFSHDEVVYGKQSLLYRMPGDEWQRFANLRLLFGYMFTHPGSNLLFMGGE
FGQSSEWNFQQSLDWHLLQYDFHKGVQQVVRDLNTLYREQPALYEKQYSHEGFRWIDYGD
AENSVLTYMRMGNEPKDYLIIACNLTPVPREGYRIGVPKTRQLKELFNSDAEKYGGSGME
NGVAKISKTPWHGFDRSVEINLPPLSVVVFR
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagttatcccgcatagcttttttacggaattcgatatcaatctgtttaaatcc
gggaagcactaccggctctacgagaaaatggggtcccacctcaccgaagtggatggtgaa
aaaggcgtgtattttgctgtatgggcgccttcggccaaatcggtttccgtggtcggcgac
ttcaattactggctggaaggagagcaccccctgaacgtccggtgggatgaaagtggcata
tgggaaggctttatccctggcctggaccagggtacgctttataaatacaagatccattcg
catgtcaatgacgtcaaaaccgaaaaagcggatccctttgcgcggtattcggagcacccg
cctaaaacagcctccgttgtttgggcggatgaccacaaatggaaggacgggacctggatg
aaaaaccgggccgggcacaacgggctggacaaaccgtattccgtgtatgaagtccatttg
ggttcctggaggcgaaatgcagacaacgaattcctgacgtatctggaattggccgaccag
cttgtggaatacgtcaaagagatgaactttacccatgtggaatttatgccggtcatggag
ttcccctacgacccttcctgggggtaccagctaacggggtattttgcgcccacttcccgc
tttgggaaaccggaggacttcaaggtactcgtggatgccctgcaccgggccggcatcggg
gtgatcctggactgggtgccgtcccacttccccgaagatgcccacgggctggggaatttt
gacgggtcgcacctttacgagcacccggaccggcgaaaaggctaccacccggactggaag
agcctgatcttcaattacggccggaacgaagtgcgcgccttcctgatcagcaacgccctc
tactggctggaccactttcacgtggacgggttgcgggtggatgccgtagcctccatgctc
tacctggactactcccgggaagaaggggagtgggagcccaatatgtacggcaataacgaa
cacctggaagccatctcctttatccgggagctcaatgcgcaggtctatgggaactacccg
ggggtgcaaaccatcgcggaggaatccacagccttctccaaggtaaccaagccggtggat
gtcggcggattgggctttggtatgaaatggatgatgggctggatgcacgacaccctggaa
tactttaagaaggaacccgtttaccggaaacaccaccagaacgatattaccttcagcatg
acctatgcgtttaccgaaaactttatgctgccgttttcgcacgacgaggtggtgtacggg
aaacaatcgctgctctaccggatgcccggggacgaatggcagcggtttgccaacctgcgg
ctgctgttcggctatatgtttacccatccggggtccaacctgctttttatggggggggaa
ttcgggcagtcgtccgagtggaacttccagcagagcctggactggcacctcttgcagtac
gattttcacaaaggggtacaacaggtggtcagggacctcaatacgctctatcgcgaacaa
cccgccctgtatgaaaagcaatacagccacgagggattccggtggatcgactacggggat
gcggagaattccgtcctcacctatatgcgcatggggaacgagcccaaagactacctgatc
atcgcctgcaacctgacgccggtgccccgggaagggtatcggatcggggtgcccaaaacc
cggcagctgaaggaattgttcaacagcgacgccgagaaatacgggggcagcggcatggaa
aacggcgtggcaaagatcagcaaaaccccctggcacggtttcgaccggtctgttgaaatt
aacctgccgcccctttcggtagtggttttccggtaa

DBGET integrated database retrieval system