KEGG   Robiginitalea biformata: RB2501_12769Help
Entry
RB2501_12769      CDS       T00992                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rbi  Robiginitalea biformata
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rbi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rbi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2051920..2052822
Genome map
AA seq 300 aa AA seqDB search
MLGIKYLSREDLDLIFETADHFKEVLSRSIKKVPSLRDITIANIFFENSTRTKLSFELAE
KRLSADVINFSAAQSSVRKGETLIDTVNNILSMKVDMVVMRHPNPGAGIFLSRHVNASII
NAGDGAHEHPTQALLDSYSIREKLGEVAGKKVVIVGDILHSRVALSNIFALQLQGAEVQV
CGPRTLIPKYVESLGVRVEPNLRKALEWCDVANMLRIQNERMDMSYFPSTREYTRQYGID
KKLLDSLGKEIVIMHPGPINRGVEITSDVADSSQSIILNQVENGVAIRMAVIYLLASRIK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttgctggggatcaagtacctgagccgggaagacctcgacctgatttttgaaactgccgac
catttcaaggaggtcctcagccgctccatcaaaaaggtgccttccctgcgggacatcacc
atcgcgaatatcttttttgaaaacagcacccggacaaagctctcctttgagctggccgaa
aaacggctttcggcggacgttatcaacttttcggcagcccagtcttccgtgcggaaaggg
gaaaccctgatcgatacggtaaacaacatcctgtccatgaaggtggacatggtggtgatg
cggcacccgaacccgggggccggtatttttctctccaggcacgtaaatgcctcgattatc
aatgcgggcgacggcgcccacgaacatcccacccaggccctgctggactcctattccatt
cgggagaagctcggggaggtggccggaaaaaaagtggttattgtgggagacatcctccat
tcccgggtggctctgtccaatatttttgccctgcaactgcagggggccgaagtccaggtt
tgcggccccaggacgctgatccccaagtatgttgaatccctgggcgtccgggtggaaccc
aacctgcgcaaggcactggaatggtgcgatgtggccaacatgcttcgcatacagaacgag
cggatggacatgagttattttccgtctacccgggagtatacccgccaatacggtatcgat
aagaaattgctcgacagcctcggcaaggaaatcgtgatcatgcacccgggcccgatcaac
cgcggggtggagatcaccagcgatgttgccgattccagccagtccatcatcctcaaccag
gtagagaatggggtggccattcggatggctgtgatttatttattagcttcaaggatcaaa
taa

DBGET integrated database retrieval system