KEGG   Robiginitalea biformata: RB2501_12939Help
Entry
RB2501_12939      CDS       T00992                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rbi  Robiginitalea biformata
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RB2501_12939
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RB2501_12939
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RB2501_12939
Enzymes [BR:rbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RB2501_12939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2099930..2101234)
Genome map
AA seq 434 aa AA seqDB search
MRYHSLNLNAAEVPFREAVIQGIAPDKGLYFPVEIPRLPDSFWKNLREKPINEIALELMR
PFVGDSIPDPDLGRILEETLSFEFPLVELSEGVYSLELYHGPTLAFKDVGSRFMARCLGH
FSKDSPAEITVLVATSGDTGGAVADGFLGVPGVEVVILYPEGKVSDIQERQLTTLGQNIR
ALRVSGSFDDCQRMVKRAFLDNDLKAARQLTSANSINVARWIPQMLYYAMAWRQLGPDSK
PPVFAVPSGNFGNICAGMLAHRMGMPCRQFVAATNVNDTVPRFMESGQYAPEKAVPTISN
AMDVADPSNFVRIRKLFGYRFPDLDAVMTSHAYTDGQTRDAMRHLHETYGYIADPHGAVG
YLGLSDYLLQDPGGPGIFLETAHPIKFRPEVERTLGLELDLPERLRGLLERDKTALPITS
YDDLRRFLMQPPGS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcgataccacagcctgaacctgaatgccgccgaggtacctttccgggaagccgttatc
caggggattgccccggataaaggcctgtatttcccggtggagattccccgcctgccggac
agcttctggaagaacctccgggaaaaacccataaatgaaattgccctggaactcatgcgg
ccctttgttggcgattccataccggaccccgacctcggccgcatcctcgaggagacgctg
agctttgaattccccctggtggagctttccgaaggggtctactccctggaactctaccac
ggccctaccctggccttcaaggatgtgggctcccggtttatggccaggtgcctggggcat
ttctctaaggattccccggctgaaattactgttttggtggccaccagcggggacacggga
ggggcagttgcagacgggttcctcggggtgcccggtgtggaggtggtgatcctgtatccc
gaaggcaaggtgagcgacatccaggaacgccagctaaccaccctggggcagaacatccgg
gcacttcgggtgtcgggcagctttgacgactgccagcgcatggtcaaacgggccttcctg
gataacgacctgaaggccgcccgacaactcacctcggcgaacagtatcaacgtggcccgg
tggattccgcaaatgctgtattacgcgatggcgtggaggcagctcgggcccgattccaaa
cccccggtattcgccgtacccagcgggaatttcgggaatatctgcgccgggatgctggcg
catcggatgggtatgccctgccggcagtttgtggcggcgaccaacgtcaacgacacggtt
ccccggtttatggaaagcggccagtacgccccggaaaaggcagtccccaccatctccaat
gccatggatgtagccgatccgagcaactttgtccgtatccggaagcttttcggctaccgc
ttccccgacctggatgcagtgatgacttcccatgcctatacggacgggcagacccgggac
gccatgcggcacctacacgagacctacgggtacatcgccgacccgcacggggcggtgggc
tacctgggcctgtcggattacctcctgcaggacccggggggtccgggtattttcctggag
acggcccaccccattaaatttcgcccggaagtggagcgtacgctggggcttgaactggac
ctgccggaacgactccgaggcctgctggaacgggataaaaccgccctgccgattaccagc
tacgacgatctccgcaggttcctgatgcagcccccgggcagttga

DBGET integrated database retrieval system