KEGG   Robiginitalea biformata: RB2501_13019Help
Entry
RB2501_13019      CDS       T00992                                 

Definition
(GenBank) diphosphate--fructose-6-phosphate 1-phosphotransferase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rbi  Robiginitalea biformata
Pathway
rbi00010  Glycolysis / Gluconeogenesis
rbi00030  Pentose phosphate pathway
rbi00051  Fructose and mannose metabolism
rbi00052  Galactose metabolism
rbi00680  Methane metabolism
rbi01100  Metabolic pathways
rbi01110  Biosynthesis of secondary metabolites
rbi01120  Microbial metabolism in diverse environments
rbi01130  Biosynthesis of antibiotics
rbi01200  Carbon metabolism
rbi01230  Biosynthesis of amino acids
rbi03018  RNA degradation
Module
rbi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB2501_13019
   00030 Pentose phosphate pathway
    RB2501_13019
   00051 Fructose and mannose metabolism
    RB2501_13019
   00052 Galactose metabolism
    RB2501_13019
  Energy metabolism
   00680 Methane metabolism
    RB2501_13019
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    RB2501_13019
Enzymes [BR:rbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RB2501_13019
Protein phosphatases and associated proteins [BR:rbi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RB2501_13019
Messenger RNA biogenesis [BR:rbi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     RB2501_13019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: EAR15250
UniProt: A4CK51
Position
complement(2122512..2123834)
Genome map
AA seq 440 aa AA seqDB search
MDPKKTFDIPSLGPARFPSPLQLSNNSGDDLFNFVRESDRVLVDVSLSGFQQARESGSRP
ECLEKSGPRETIFFDPGKTTAAIVTCGGLCPGINNVIRSLVMALHYFYGVKRIIGVRYGY
EGLSRDCPHEFMELTPDKVKDIHEFGGTILGSSRGAHPVSEMVDTLVENRIDILFTVGGD
GTLKGAHAIGDEIAKRGLNIAVAGIPKTIDNDINLIDKSFGFETAFDVASPIVRDAHNEA
IGAFNGISIVKLMGRDSGYIAASTALAMPVVNFVLVPEMPLKLEGEGGFLQALEDRLQRK
HHAVIVVAEGAGQHLFDDDRRVTDASGNVKHKDIGILLKDRIQEHFGQSGTPVTIKYIDP
SYIIRSAPANANDSLFSNRLAYQAVHGAMAGKTQFVAGRVHNRFVYLPISKVTDRRKKID
MEGEFWFAVLQSTGQPFKMG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggatccgaaaaaaacttttgacatcccttccctggggcccgcccggttcccctccccc
ctgcaactgagcaataactcgggagacgacctcttcaattttgtccgggagtccgaccgc
gtgctggtggacgtatccctgagcggtttccaacaggcccgggagtccgggtcccggccg
gagtgtctggaaaaatccgggccccgggaaactattttctttgacccgggaaaaaccact
gcggccatcgtcacctgcgggggcctgtgcccgggcatcaacaacgttatccggagcctg
gtgatggccctgcattatttctacggggttaaacggatcatcggggtgcgctatggctat
gaagggttgtccagggattgcccgcacgaatttatggaactcaccccggacaaggtaaag
gacatccacgagttcgggggcaccatcctggggtcttcccggggggcacaccccgtctcg
gagatggtggataccctggtggaaaaccggatcgatatcctctttaccgtgggcggggac
ggcacgctcaagggggcccatgccatcggcgatgaaattgcaaagcggggcctgaacatc
gccgtggccggaattccgaaaaccatagacaacgacatcaacctcatcgataaatctttc
ggctttgaaacggcctttgatgtggcgagcccgattgtccgggatgcccacaacgaggcc
atcggggcctttaacggaatttccattgtaaagctcatggggcgggacagcggctatatt
gcagcctccaccgccctggccatgccggtggtcaactttgtcctcgtccccgaaatgccg
ttgaaactcgaaggggaaggtggtttcctgcaggccctggaggatcggctgcaacgcaag
caccacgccgtaatcgtggtggctgaaggcgccgggcaacacctgttcgatgacgaccgg
cgcgttacggacgcctcgggcaatgtaaagcacaaggatatcgggatcctgctgaaagac
cggatacaggagcattttggccaatccgggaccccggtcaccatcaagtacatcgacccg
agctatatcatccgcagcgccccggccaatgccaacgacagcctattcagtaaccggctc
gcctaccaggccgttcacggggccatggccgggaagacccaatttgtggccggtcgcgtc
cacaaccgttttgtctacctgccaatctccaaggtgaccgaccgccggaaaaagattgac
atggagggcgaattctggtttgccgtcctgcagagcaccgggcagccttttaagatgggt
taa

DBGET integrated database retrieval system