KEGG   Robiginitalea biformata: RB2501_13019Help
Entry
RB2501_13019      CDS       T00992                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rbi  Robiginitalea biformata
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RB2501_13019
   01230 Biosynthesis of amino acids
    RB2501_13019
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB2501_13019
   00030 Pentose phosphate pathway
    RB2501_13019
   00051 Fructose and mannose metabolism
    RB2501_13019
   00052 Galactose metabolism
    RB2501_13019
  Energy metabolism
   00680 Methane metabolism
    RB2501_13019
Enzymes [BR:rbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RB2501_13019
Protein phosphatases and associated proteins [BR:rbi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RB2501_13019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2122512..2123834)
Genome map
AA seq 440 aa AA seqDB search
MDPKKTFDIPSLGPARFPSPLQLSNNSGDDLFNFVRESDRVLVDVSLSGFQQARESGSRP
ECLEKSGPRETIFFDPGKTTAAIVTCGGLCPGINNVIRSLVMALHYFYGVKRIIGVRYGY
EGLSRDCPHEFMELTPDKVKDIHEFGGTILGSSRGAHPVSEMVDTLVENRIDILFTVGGD
GTLKGAHAIGDEIAKRGLNIAVAGIPKTIDNDINLIDKSFGFETAFDVASPIVRDAHNEA
IGAFNGISIVKLMGRDSGYIAASTALAMPVVNFVLVPEMPLKLEGEGGFLQALEDRLQRK
HHAVIVVAEGAGQHLFDDDRRVTDASGNVKHKDIGILLKDRIQEHFGQSGTPVTIKYIDP
SYIIRSAPANANDSLFSNRLAYQAVHGAMAGKTQFVAGRVHNRFVYLPISKVTDRRKKID
MEGEFWFAVLQSTGQPFKMG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggatccgaaaaaaacttttgacatcccttccctggggcccgcccggttcccctccccc
ctgcaactgagcaataactcgggagacgacctcttcaattttgtccgggagtccgaccgc
gtgctggtggacgtatccctgagcggtttccaacaggcccgggagtccgggtcccggccg
gagtgtctggaaaaatccgggccccgggaaactattttctttgacccgggaaaaaccact
gcggccatcgtcacctgcgggggcctgtgcccgggcatcaacaacgttatccggagcctg
gtgatggccctgcattatttctacggggttaaacggatcatcggggtgcgctatggctat
gaagggttgtccagggattgcccgcacgaatttatggaactcaccccggacaaggtaaag
gacatccacgagttcgggggcaccatcctggggtcttcccggggggcacaccccgtctcg
gagatggtggataccctggtggaaaaccggatcgatatcctctttaccgtgggcggggac
ggcacgctcaagggggcccatgccatcggcgatgaaattgcaaagcggggcctgaacatc
gccgtggccggaattccgaaaaccatagacaacgacatcaacctcatcgataaatctttc
ggctttgaaacggcctttgatgtggcgagcccgattgtccgggatgcccacaacgaggcc
atcggggcctttaacggaatttccattgtaaagctcatggggcgggacagcggctatatt
gcagcctccaccgccctggccatgccggtggtcaactttgtcctcgtccccgaaatgccg
ttgaaactcgaaggggaaggtggtttcctgcaggccctggaggatcggctgcaacgcaag
caccacgccgtaatcgtggtggctgaaggcgccgggcaacacctgttcgatgacgaccgg
cgcgttacggacgcctcgggcaatgtaaagcacaaggatatcgggatcctgctgaaagac
cggatacaggagcattttggccaatccgggaccccggtcaccatcaagtacatcgacccg
agctatatcatccgcagcgccccggccaatgccaacgacagcctattcagtaaccggctc
gcctaccaggccgttcacggggccatggccgggaagacccaatttgtggccggtcgcgtc
cacaaccgttttgtctacctgccaatctccaaggtgaccgaccgccggaaaaagattgac
atggagggcgaattctggtttgccgtcctgcagagcaccgggcagccttttaagatgggt
taa

DBGET integrated database retrieval system