KEGG   Robiginitalea biformata: RB2501_13234Help
Entry
RB2501_13234      CDS       T00992                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rbi  Robiginitalea biformata
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:rbi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rbi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rbi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rbi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rbi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rbi00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:rbi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2178514..2179488
Genome map
AA seq 324 aa AA seqDB search
MHKIAVLTSGGDSPGMNAAIRSVVRTCAYMNVECMAIYRGYQGMIEGDFVAMNARSVNNI
INKGGTILKSARCEDFKTPEGRKKAHEQLVQAGISGFVVIGGDGSFTGATIFNKEYDFPV
IGIPGTIDNDIFGTRYTLGFDTALNTVVDAIDKIRDTASSHNRLFFVEVMGRDVGHIALN
AGVAAGAEEILIPEENLGLDRLLESLRRSKKTGKSSSIVVVAEGDKTGKNVFELKEYVEE
HLPIYDVRVSVLGHMQRGGPPSAFDRVLASRMGVKAVEALIAGKTNLMVGIIDNEIVLTP
IAEAIKGHTKIDRELVRVSDIMTI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagattgcggtgctcacctcgggaggagactccccgggcatgaatgccgccatc
cgttcggtggtccggacctgcgcctacatgaatgtggaatgtatggccatctaccgcggt
taccaggggatgattgagggagacttcgtggcaatgaatgcccggagcgtcaacaacatc
atcaacaagggaggaaccatcctcaaatcggcccggtgcgaggacttcaaaaccccggaa
gggagaaaaaaagcccacgagcaactggtccaggccggaattagcgggtttgtggtcatc
gggggggacggcagttttaccggggccaccatattcaataaggaatacgatttcccggtg
atcggaatccccgggaccatcgacaacgatatcttcggtacccggtatacgctgggcttt
gacacggccctcaatacggtggtggacgccatcgacaagatccgggatacggccagctcc
cacaaccgattgttttttgtggaggtcatgggccgggatgtcggccatattgcgctcaat
gcgggggtagcggccggtgccgaggaaatattgatccccgaggaaaacctggggctggac
cgcctgctggaatccctcaggcgcagcaagaaaaccggcaagtcctcgagtatcgtcgta
gtggcggaaggggataagaccggtaaaaacgtctttgaactcaaggagtacgtagaggag
cacctgcccatttacgatgtccgggtttcggttctgggccatatgcagcggggcgggcca
ccaagtgcctttgaccgcgtgttggcgagccggatgggggtaaaagccgttgaggccctc
atcgccgggaagaccaacctgatggtgggaatcatcgacaacgaaattgtactgaccccg
attgccgaggcgatcaaagggcataccaaaatagaccgggaactcgtacgcgtttccgat
ataatgactatataa

DBGET integrated database retrieval system