KEGG   Robiginitalea biformata: RB2501_13504Help
Entry
RB2501_13504      CDS       T00992                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rbi  Robiginitalea biformata
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rbi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rbi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2248295..2249071
Genome map
AA seq 258 aa AA seqDB search
MKYKQRIVVKVGTNVMTNRDNRIVRPVLRNLVSQVAELYERDIITTLVSSGSVIAGREVL
GKSKIKDKTQRRQVYSAIGQPRMMRLYYNIFHDYGMKCAQVLPTKRDFNPGIHRENMINC
YEGLMSEGVIPIANEDDAVSVTMSMFSDNDELAGLVAQLLNVDKLILLTDTDGLYTGHPD
DAGTELISHVSVDDDVDQFIKENGKGEAEGRGGMGSKLDFAQKTAAKNIPTFIANGKKPN
VILDIMDGKNVGTKITMN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaacagcgaatagtcgtaaaagtagggacgaacgtcatgaccaaccgggac
aaccggatcgtccgcccggtcctgcgcaacctggtatcccaggtagccgaactgtacgaa
cgggatatcattaccaccctggtttcctccggttccgtcattgcggggcgggaagtcctg
ggaaaatccaaaatcaaggacaagacccagcgccgccaggtttattcggccatcgggcag
ccgcggatgatgcggttgtattacaacatcttccacgattacgggatgaaatgtgcccag
gtattgcccaccaaacgcgatttcaacccgggaatccaccgggagaatatgatcaactgt
tacgaagggctgatgtccgaaggggtgatcccgattgccaatgaagacgatgccgtgtcg
gtgaccatgtccatgttctcggacaacgatgagctcgccgggctggtggcccagctcctg
aacgtggataaactgatcctgctgacggatacggacggcttgtatacaggccacccggat
gatgccggcacggagctgatcagccatgtatccgtggatgacgatgtagaccagtttatc
aaggagaacggcaagggtgaagcggaaggccgcggcggcatgggctccaagctggatttc
gcccagaaaaccgctgccaagaatatcccgacattcattgccaacggcaagaagccgaat
gtcatcctggatattatggacggtaaaaatgtaggaaccaaaatcacaatgaattaa

DBGET integrated database retrieval system