KEGG   Robiginitalea biformata: RB2501_13674Help
Entry
RB2501_13674      CDS       T00992                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
rbi  Robiginitalea biformata
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rbi00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rbi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2284532..2285839
Genome map
AA seq 435 aa AA seqDB search
MGSFRIEGGHRLQGEITPQGAKNEALQILCAVLLTSEPVTVHNIPDIVDVNKLIAILEDL
GVKIQKKGKGSYTFRSDDINMDYLQSDAFKADGRSLRGSIMLVGPLLARFGQGYIPKPGG
DKIGRRRLDTHFEGFIKLGASFRYNKEEHFYGVEAKKLKGTDMLLDEASVTGTANIVMAA
VLAEGTTTIYNAACEPYLQQLCKMLNRMGARITGVGSNLLTIEGVESLGGTEHRMLPDMI
EIGSWIGLAAMTQSELTIKDVSWDDLGLIPTTFRKLGITLERRDDDIHIPAHTDGYEIQN
YIDGSILTIADAPWPGLTPDLLSILLVVATQARGEVLIHQKMFESRLFFVDKLLDMGAKV
ILCDPHRATVIGHNFQSTLKATTMVSPDIRAGVSLLIAALSAKGTSTIHNIEQIDRGYEA
IDTRLQAIGARITRV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggatcattcagaattgaaggagggcatcgcctgcagggtgaaatcacgccccagggg
gccaagaacgaggccttgcagatactttgtgccgtcctgctgacatccgaacccgtaact
gtccacaacatcccggacatcgtggatgtcaacaaactcattgcaatcctcgaggacctg
ggggttaaaatccagaaaaagggcaagggttcctataccttccgttcggacgatattaac
atggactacctgcaaagcgatgccttcaaggcggatggcaggagcctccggggttccatc
atgctggtgggcccgctgctggcgcgattcgggcaggggtatatcccgaagccgggcggg
gataaaattggacgccgacgtctggacacccattttgaagggtttatcaagctgggggca
tccttccgctataataaggaggaacacttttacggggtggaggccaaaaaactcaaagga
accgatatgctcctggatgaggcctccgttacaggtaccgcaaatatcgtcatggccgcg
gttttggcggaaggcacaactaccatctacaacgctgcctgcgaaccgtatttgcagcaa
ttgtgtaaaatgctgaaccgcatgggggcccgcatcacaggggtagggtctaacctgctc
accatcgaaggggtggaatccctggggggaaccgagcaccgcatgctccccgatatgatc
gagatcggcagctggattgggttggccgccatgacccaaagcgagttgaccatcaaggac
gtgagctgggacgacctgggcctgatcccgacgaccttccggaagttggggatcaccctg
gagcgccgggacgacgacatccatatcccggcccatacggacggatatgaaatacagaat
tacatcgacgggtccatccttacgattgcagacgcgccctggccggggctgacgccggac
ctgctgagtatcctcctggtagtggcgacacaggccaggggagaagtcctcatccaccag
aaaatgtttgaaagccggttattcttcgtggataagctgctggacatgggggcaaaagtg
atcctttgcgacccgcaccgggccacggtcatcggccacaatttccaatcgacgctcaag
gcaaccaccatggtgtctccggatatccgcgccggcgtttccctgctgatcgccgccctt
tcggcaaaagggacgtccaccattcacaacatcgaacaaatcgatcgcgggtacgaggcc
atcgacacgcgcctgcaggcaatcggagcccggattacccgggtctga

DBGET integrated database retrieval system