KEGG   Robiginitalea biformata: RB2501_15154Help
Entry
RB2501_15154      CDS       T00992                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rbi  Robiginitalea biformata
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rbi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:rbi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2588100..2589419)
Genome map
AA seq 439 aa AA seqDB search
MMQLIAYPPRSEWSELLKRPAASAQSLERAVEEVFTAVRENGDQAVCDFTRQFDGVSLES
PVLPETEISRLAELVPGHLRDAIDLAYENIRQFHEAQKTPAVRVQTRPGVDCWQEKKPID
KVGIYIPGGTAPLFSTVLMLAIPAAIAGCREVVLCSPPDQAGNLHPAICYAARKCGVRTV
CRAGGIQAIAAMTYGTREIPAVYKIFGPGNQYVTQAKQRAVREGVAIDMPAGPSEVLVAA
DDSANPAYIAADLLSQAEHGRDSQVLLLTDDAELPGAVRRELETMLRELPRREIASDAID
NSRMILLESSGEIAEMINQYAPEHLIICHRQEEFLLREIRNAGSVFLGNLTPESAGDYAS
GTNHTLPTNGYARQYSGVNLDSFTKAITYQRLSDRGVREIGPAIITMAEAEGLSAHALAM
KLRVADLHEIPNKKEKEDA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagctcattgcctatccgccgcggtccgaatggtccgaattgttaaaacgaccc
gcggcttccgcccaatccctggaacgcgccgtggaagaggtattcacagccgtccgcgaa
aacggggatcaggccgtctgcgactttacccggcaattcgacggggtttccctggaatcc
ccggtgctccccgaaacggaaatatcccggctggcggagctggtgcccgggcatctccgg
gatgccatcgacctggcctatgagaatatccggcaattccacgaggctcagaaaaccccg
gcggtccgggtgcaaacccgcccgggggtggattgctggcaggaaaagaaacccatcgac
aaggtgggcatctatatcccgggcggtaccgccccgttattttcaaccgtactgatgctt
gccatcccggctgccatagccggttgccgcgaggtggtgctgtgctctccacccgatcag
gccggtaacctgcacccggccatttgctatgcggcccgcaaatgcggtgtccgaaccgtt
tgccgggcggggggcatccaggccattgccgccatgacctacggcacccgtgaaatccct
gctgtctataagattttcggcccgggaaaccaatatgttacccaggccaaacaacgggct
gtccgggaaggtgtcgccatcgatatgccggccggtccgagcgaggtcctggtggctgcc
gacgactccgccaacccggcctatatcgctgcggatttgctcagccaggcagaacacggg
cgggacagccaggtattgctgctcacggatgacgcggagttgcccggggccgtacgccgc
gaattggaaaccatgctgcgggaactcccgagacgggaaattgcctcggatgccatcgac
aacagcaggatgatcctcctggaatcctccggggaaatagccgagatgatcaaccagtat
gccccggaacacctgatcatctgccacaggcaggaagaatttctgctgcgggagatccgc
aacgcgggttccgtattcctgggcaatctcactcccgaaagtgccggggattacgcttcg
gggaccaaccacacactgcccaccaacgggtatgcccggcaatacagcggggttaacctg
gatagttttaccaaggcgatcacctaccagcgtctcagcgatcggggggtacgggaaatt
ggcccggcaattatcaccatggccgaggccgagggtctgtcggcccatgcgctcgccatg
aaactccgagtagcggacctgcatgagataccgaacaaaaaagagaaggaagatgcctga

DBGET integrated database retrieval system