KEGG   Robiginitalea biformata: RB2501_15154Help
Entry
RB2501_15154      CDS       T00992                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rbi  Robiginitalea biformata
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RB2501_15154
  Amino acid metabolism
   00340 Histidine metabolism
    RB2501_15154
Enzymes [BR:rbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RB2501_15154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2588100..2589419)
Genome map
AA seq 439 aa AA seqDB search
MMQLIAYPPRSEWSELLKRPAASAQSLERAVEEVFTAVRENGDQAVCDFTRQFDGVSLES
PVLPETEISRLAELVPGHLRDAIDLAYENIRQFHEAQKTPAVRVQTRPGVDCWQEKKPID
KVGIYIPGGTAPLFSTVLMLAIPAAIAGCREVVLCSPPDQAGNLHPAICYAARKCGVRTV
CRAGGIQAIAAMTYGTREIPAVYKIFGPGNQYVTQAKQRAVREGVAIDMPAGPSEVLVAA
DDSANPAYIAADLLSQAEHGRDSQVLLLTDDAELPGAVRRELETMLRELPRREIASDAID
NSRMILLESSGEIAEMINQYAPEHLIICHRQEEFLLREIRNAGSVFLGNLTPESAGDYAS
GTNHTLPTNGYARQYSGVNLDSFTKAITYQRLSDRGVREIGPAIITMAEAEGLSAHALAM
KLRVADLHEIPNKKEKEDA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagctcattgcctatccgccgcggtccgaatggtccgaattgttaaaacgaccc
gcggcttccgcccaatccctggaacgcgccgtggaagaggtattcacagccgtccgcgaa
aacggggatcaggccgtctgcgactttacccggcaattcgacggggtttccctggaatcc
ccggtgctccccgaaacggaaatatcccggctggcggagctggtgcccgggcatctccgg
gatgccatcgacctggcctatgagaatatccggcaattccacgaggctcagaaaaccccg
gcggtccgggtgcaaacccgcccgggggtggattgctggcaggaaaagaaacccatcgac
aaggtgggcatctatatcccgggcggtaccgccccgttattttcaaccgtactgatgctt
gccatcccggctgccatagccggttgccgcgaggtggtgctgtgctctccacccgatcag
gccggtaacctgcacccggccatttgctatgcggcccgcaaatgcggtgtccgaaccgtt
tgccgggcggggggcatccaggccattgccgccatgacctacggcacccgtgaaatccct
gctgtctataagattttcggcccgggaaaccaatatgttacccaggccaaacaacgggct
gtccgggaaggtgtcgccatcgatatgccggccggtccgagcgaggtcctggtggctgcc
gacgactccgccaacccggcctatatcgctgcggatttgctcagccaggcagaacacggg
cgggacagccaggtattgctgctcacggatgacgcggagttgcccggggccgtacgccgc
gaattggaaaccatgctgcgggaactcccgagacgggaaattgcctcggatgccatcgac
aacagcaggatgatcctcctggaatcctccggggaaatagccgagatgatcaaccagtat
gccccggaacacctgatcatctgccacaggcaggaagaatttctgctgcgggagatccgc
aacgcgggttccgtattcctgggcaatctcactcccgaaagtgccggggattacgcttcg
gggaccaaccacacactgcccaccaacgggtatgcccggcaatacagcggggttaacctg
gatagttttaccaaggcgatcacctaccagcgtctcagcgatcggggggtacgggaaatt
ggcccggcaattatcaccatggccgaggccgagggtctgtcggcccatgcgctcgccatg
aaactccgagtagcggacctgcatgagataccgaacaaaaaagagaaggaagatgcctga

DBGET integrated database retrieval system