KEGG   Robiginitalea biformata: RB2501_15379Help
Entry
RB2501_15379      CDS       T00992                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rbi  Robiginitalea biformata
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rbi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2632167..2632763)
Genome map
AA seq 198 aa AA seqDB search
MPYRHLEEYNIEVTREVTDHYERILREIGEDPAREGLLKTPERAAKAMLFLTQGYRQDAV
EILKGAMFRESYSEMVLIKDIEVYSLCEHHMLPFYGKAHVAYIPDGHIVGLSKIPRVVDV
FARRLQVQERLTDDILECINTTLKPRGVAVVIEAAHMCMMMRGVQKQNSVTTTSGFRGQF
EKSETRNEFLKLISSELH
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcgccaccttgaagagtacaatattgaggtcacccgggaagttaccgaccac
tacgagcgcatcctcagggagatcggggaggacccggcccgggagggcctgctcaagacc
ccggaacgagccgccaaagccatgctgttcctcacccaggggtaccggcaggatgcggtc
gaaatcctcaagggcgccatgttccgggaatcctatagcgaaatggtccttatcaaggat
atcgaggtgtactccctctgcgaacaccatatgctccctttttacggcaaggcccacgtg
gcctacatcccggacggccacatcgtcggcctgagcaaaatcccccgggtggtggatgtc
tttgcccgccgcctccaggtgcaggaacgcctcacggacgatatcctggaatgtatcaat
accaccttgaagccccggggggttgccgtggtcattgaggcagcccatatgtgcatgatg
atgcggggcgtacagaaacaaaactcggttacgacaacctccgggttccggggccagttc
gaaaaaagcgaaacccggaacgaattcctgaaactgatcagttcggaactccactga

DBGET integrated database retrieval system