KEGG   Robiginitalea biformata: RB2501_15404Help
Entry
RB2501_15404      CDS       T00992                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rbi  Robiginitalea biformata
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2635083..2636774)
Genome map
AA seq 563 aa AA seqDB search
MAVLHASKTTDSAVLRSVFREARRAFKRAEAYGSYLNPEIGHRANGPALPVFTDDSQRVL
QPLGLQKVEETLFEGETYPGALYQEIRITRGLLRNLLGYIRKHPPTPKRYFISQHQQLMR
VASLSITGFDTPVSLWGLDEAAVSLESMLQVYEIVLQRQIRQTEPGLDDRFVSALQDAVA
YLRSGRDFMAFNRYEFLRDRFNPMMRAWVAIRKASGLWDGEEAGPFNMDAPTFFEPDSFN
ASFFMPVNNSRITDAQVLLGEKLFYDPNLSKSGTMSCASCHLPEQAWADGRVASPDNVGL
PLERNTPTLVNSIFQQAFFWDGRSDDIMAQIRSVFTNEKEFDSGVHTFSDAILQDTSYIR
LFEEAYSGVPTRNREVIKALSAYISTLTGMDSRFDRNIRGEETTLTESEIRGFNLFSGKA
LCATCHFLPLTNGTVPPFFLETEKEVIGVPETAANAAWDADPGFYTQFEEPIHLGMFKTP
TVRNAAQTAPYMHNGVYATLEQVIEFYNLGGGTGLGFDLEHQTLPFDELQLTAREISDLT
AFIRTLDDLPPSPDAKQKQSPNL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgttgcatgcatccaaaaccaccgattcagctgtcctgcgcagcgttttccgc
gaggcgaggcgggcgtttaaaagagcagaggcctacggctcctatctcaacccggagatt
gggcatcgggccaacggtccggccctgccggttttcaccgacgacagtcagcgggtactg
caacccctgggtttacaaaaggttgaggaaacgctatttgaaggcgaaacataccctggg
gcgctctatcaagagatccggattacccggggacttttgcgaaatttattgggctatata
cgaaaacaccccccgacccccaaacggtattttatttcccagcaccagcaactcatgcgt
gtggccagtttatctattaccgggtttgatacgccggtgagcttatgggggctggatgaa
gcagcagtttccctggaaagtatgctgcaggtatatgaaatcgtcctgcaacgccaaatc
cggcagacggagcctggcctggacgacaggtttgtgagtgcgcttcaggatgctgttgct
tacctgcgatcgggcagggattttatggcctttaaccggtatgaattcctcagggaccgt
ttcaatccgatgatgcgtgcctgggttgccattcgcaaggccagcggactttgggacggg
gaagaagcggggccatttaatatggacgccccaacattttttgagccggacagcttcaat
gcgtctttttttatgccggttaataatagccggattacggatgcccaggtacttctgggt
gaaaaactcttttacgaccccaatctgtcaaaatccggaaccatgtcctgtgcatcctgc
catttgcccgaacaggcatgggcagatggccgggttgccagtccggataacgttggcctg
cccctggaacgaaacacgcccacattggtgaattcaatcttccagcaggcatttttctgg
gatggccgctcagatgatattatggcacaaatccgttccgtatttacaaatgaaaaggag
tttgacagcggtgtccataccttttcggatgccatcttacaggacacgtcctatatacgc
ctctttgaggaagcctattcaggcgtacccacccgaaaccgggaagttatcaaggcgcta
tcggcctatatcagtacgctaaccgggatggattcccgtttcgatcggaatattcgcggg
gaagaaaccacattaaccgaatcggaaatacgcggattcaacctgttttcaggcaaagcg
ctttgcgcaacctgtcatttcctgccactcaccaacgggaccgtgccgccatttttcctg
gaaactgaaaaagaagtgattggcgtcccggaaactgcggccaatgccgcctgggatgcg
gacccgggcttttatacccaatttgaggaacccatccacctggggatgttcaaaacccca
acggtgcgaaatgcggcccaaacggcgccctacatgcacaacggcgtgtatgccacgctg
gagcaggtcatcgaattctacaacctcggcgggggcacaggcctgggattcgacctggag
caccaaacgctcccatttgacgaattgcagctcacggctcgggaaatttccgacctgacc
gcatttatacggaccctggacgacctgccaccttccccggacgccaaacaaaagcaatca
cccaacctgtga

DBGET integrated database retrieval system