KEGG   Robiginitalea biformata: RB2501_15929Help
Entry
RB2501_15929      CDS       T00992                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rbi  Robiginitalea biformata
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2751687..2752328)
Genome map
AA seq 213 aa AA seqDB search
MKDTLKHRGKRNQLAGAVAAKGIEDKAVLDAIRAVPRHLFMDSSFEDHAYQDKAFPIAAG
QTISQPYTVAYQTSLLGLKPGDKVLEIGTGSGYQTAVLLHLRLRVYTIERQLELFKKTNL
FFRRMGYRPKKFVFGDGYKGLPEEAPFDGIIVTAGAPMVPRELLSQLAIGGRMVVPVGEE
DQTMMLIRRASKTKFERQAGGAFRFVPMLEDKG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggataccttaaagcaccgtgggaagaggaaccaactggccggggcagtagccgct
aaaggcatagaggacaaggcggtcctggacgccattcgcgccgttcccaggcacctcttc
atggacagcagttttgaggaccacgcctaccaggacaaagcgttccccatagcggcgggc
caaacgatttcccaaccttatactgtggcttaccaaacttctctgctgggcttgaaaccc
ggagacaaggtattggagatcggaaccggcagcggctaccagacggcggtcctgctgcat
ttgaggctccgggtctacaccatcgaaaggcaattggagctctttaaaaaaacgaacctt
tttttcaggcgtatggggtaccggcccaaaaagtttgtctttggcgacggttacaaaggc
ctccccgaagaggccccctttgacgggattatcgtaacggccggtgccccgatggtaccc
cgggaattgctttcccagctggccataggcggccggatggtggtgccggtaggggaggaa
gaccagacgatgatgcttatccgccgcgcctccaaaacaaaattcgaaaggcaggcagga
ggggcattccgctttgtcccgatgctggaggacaagggctga

DBGET integrated database retrieval system