KEGG   Rickettsia bellii OSU 85-389: A1I_00170Help
Entry
A1I_00170         CDS       T00602                                 

Definition
folate synthesis bifunctional protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A1I_00170
Enzymes [BR:rbo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     A1I_00170
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     A1I_00170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32335..33651
Genome map
AA seq 438 aa AA seqDB search
MIYISIGSNLGNRFLNIRRALNLLKSHGFVLLRQSIIFETQAILPPNADSSWDRPYYNMV
VQGTTALLPNALLTVLKKIEQQIGRKENYDKWCPRVIDLDILLWDSYHIDLPDLKIPHSQ
LLNRPFLIHLIASLSIECRYICPDNNLYNDKAFAEIAHLIENQGVIRSLVLNPQFVGILN
ITPDSFSDGGLSFHKEDAVKNFVHLMDAGSSMIDLGAQSTRPSAFMISEDEEYTGLDSVL
EELKGVIEKTEALISIDSFSPEVIKRILKKYPVHCINLVKTNLDNDTLRLIADYNCKIVI
MHSLTVPPQKQQCLDFDKSLIISLNIWAEQEIAKLEKCGFDRKDIIFDPGIGFGKSVYQN
LHILQNIQEFKKLGCEILVGHSRKSYISTFYNSIAKERDLETIAISKYLAENGVNYLRVH
NVEDHQRFFVTQAYTLNK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatttatatttctataggcagtaatttaggcaacaggtttttaaatattagaagagct
ctaaatttactcaaaagccatggttttgtactacttaggcaatctattatttttgagacg
caagctattctaccacctaacgcagatagtagttgggatagaccatattataacatggtg
gtacaaggtactactgctttattgcccaatgcactgctaactgtgcttaaaaagattgaa
cagcaaataggcagaaaagagaattatgataaatggtgtccacgagttattgatctagat
attttactttgggatagttatcatatagatttaccagatttaaaaatacctcattcccaa
ttattaaatagaccgtttcttattcatcttattgcaagcttgagcatagaatgccgttat
atttgccctgataataacctctataacgataaagcttttgcagaaatagcccatttaatt
gaaaatcaaggggttatacgctcacttgttttaaatcctcaatttgttggtattttaaat
attactcctgattctttttctgatggaggtttgagttttcataaggaagatgccgttaag
aattttgtacatttaatggatgcaggatctagtatgatcgatcttggtgctcagtcaaca
cgtccctctgcttttatgattagtgaggatgaagaatatactgggcttgatagtgttctt
gaagagctaaaaggagttatagaaaaaacagaagcccttattagtatcgatagtttttcg
cctgaagtgattaaacgaattctaaaaaaatatcccgttcattgtattaacttagttaaa
actaatttagataatgatacattacgattaattgcagattataattgtaaaattgttatt
atgcattcgctaaccgttccgccacaaaaacagcaatgtcttgattttgataaatctctg
attattagcttaaatatatgggcagagcaagaaatagcaaaattagaaaaatgtggattt
gatagaaaagatataatttttgatccgggtataggttttggaaagtctgtttatcaaaat
ttacatatattacaaaatattcaagaatttaaaaaattaggatgtgagatattagttggt
cactcaagaaaatcttatatttctactttctataattctatcgcaaaagaaagagattta
gaaacaatagcaatatcaaaatatttagctgaaaatggggtcaactatttacgagtgcat
aatgttgaagatcatcaaagattctttgtaacacaggcatatactcttaataaataa

DBGET integrated database retrieval system