KEGG   Rickettsia bellii OSU 85-389: A1I_00805Help
Entry
A1I_00805         CDS       T00602                                 

Definition
(GenBank) ParB-like partition proteins
  KO
K03497  chromosome partitioning protein, ParB family
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
Transcription factors [BR:rbo03000]
 Prokaryotic Type
  Other transcription factors
   Others
    A1I_00805
Chromosome and associated proteins [BR:rbo03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    A1I_00805
Cytoskeleton proteins [BR:rbo04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   A1I_00805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParBc HTH_3 TrmB HTH_19 Latarcin HTH_17
Motif
Other DBs
NCBI-ProteinID: ABV78561
Position
149723..150586
Genome map
AA seq 287 aa AA seqDB search
MKNKGLGRGLSSLLGEEVISTEKESLEIVQIINIDRIKPNENQPRKHFEYDKIKELSDSI
LNNGLLQPIIIDNSFQIIAGERRWRACKLAKISEIPVIIKNLDAKESMEIALIENIQRSD
LTVMEEARGFKYLVENFNYTAEKLAERLGKSRSHIANLLRLNNLPQSIQNKLDENTLSMG
HARCLINHEHAEIIANYVIDNDLNVRQTEELVRQWSQNEYTKYPDNNRIGKQLFKEKTED
NDLQSLVKILSEKFNIKVTIENYSLGGKLIFHYKDLKELDKILLELS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaagggttaggtagaggcttgtcttcattattaggagaagaggttatatct
acagaaaaagaaagtttagaaatagtacaaattataaatattgatagaataaaaccaaat
gaaaatcagcctagaaaacattttgaatatgataaaataaaagaattatcagattctata
ttaaataatggtttacttcagcctattattattgataatagttttcaaattatagcaggt
gaaagacgctggcgtgcatgtaaattagcaaaaatttctgagataccggtaattataaaa
aatttagatgctaaagagagtatggaaatagcattaattgagaatatacaaagatcggat
ttaacagtcatggaagaagctcgtggttttaaatatttggtagaaaattttaattacaca
gcagaaaaattagcagaaagacttggtaaaagtcgtagtcatatagctaatttgctaaga
ctcaataatttaccacaatctattcaaaataaattagatgaaaatacacttagtatggga
catgctagatgcttaataaatcatgagcatgcggaaataatagcaaattatgttatagac
aatgatttgaatgtgcgtcaaacagaagagttagtaaggcaatggtctcaaaatgaatat
acgaagtatcctgataataatagaataggaaaacagctttttaaagaaaaaacagaagat
aatgatttacaatcattagtaaaaattttatcagaaaaatttaatataaaagtgacaata
gaaaattattctttaggaggaaagttaatattccattataaggatttaaaagaattagat
aaaattttgttagagttaagttaa

DBGET integrated database retrieval system