KEGG   Rickettsia bellii OSU 85-389: A1I_00850Help
Entry
A1I_00850         CDS       T00602                                 

Definition
(GenBank) ABC transporter permease protein
  KO
K02066  
phospholipid/cholesterol/gamma-HCH transport system permease protein
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
ABC transporters
Module
Phospholipid transport system
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    A1I_00850
Transporters [BR:rbo02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   gamma-Hexachlorocyclohexane transporter [MD:M00669]
    A1I_00850
   Phospholipid transporter [MD:M00210]
    A1I_00850
   Mce system transporter [MD:M00670]
    A1I_00850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(155767..156546)
Genome map
AA seq 259 aa AA seqDB search
MLLNIANSIGKRTIRLAQSIGKFSIFSLAAITSIIRPPLYFSLIIKQLLFIGFYSLPVVA
MTTFFSGAVLALQSYTGFSRFSAESSIATVVVLSLTRELGPVLAGLMVAGRVGASIAAEI
GTMRVTEQVDALYTLSTDSIKYLVFPKVIAAIITMPCLVLIGDVIGVMGGYLVGVYKLDF
NSSTYLTSTFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVN
SSILILISNYLITELFFKV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaatatagctaattctattggtaaacgtaccataagactagcacaaagtatc
ggcaaattttctatatttagcttagctgccattactagcattataagaccacctttatat
tttagtttaattatcaaacaattattatttatcggcttttattctttgcctgttgtcgcc
atgactacctttttctcaggtgcagtattggcattacagagttatacaggattttctcgc
ttttctgccgaaagttctatcgcaactgtagtggtgttatccttaactagggaactcgga
ccagtgcttgcggggttaatggtagcaggaagagtaggagcatcaattgcagcggaaata
ggtactatgagagttaccgaacaagtagatgctttatatactctctctacagattctatt
aaatatcttgttttcccaaaagtaattgcagctattattactatgccttgtctagtttta
atcggcgatgtaatcggggttatgggaggttatttagttggcgtgtataagcttgacttc
aacagtagcacttatctaactagcacttttcaatatttagagccaatagacgtaatatct
ggtcttgttaaagctggcgttttcggctttattatttctataataagctgctatagtggt
tattattcaggtaaaggagctaaaggtgttggacgagctactacttctgcggtagtaaat
tcttccattttaatcctaattagtaactacttaataaccgaattattttttaaagtataa

DBGET integrated database retrieval system