KEGG   Rickettsia bellii OSU 85-389: A1I_00855Help
Entry
A1I_00855         CDS       T00602                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A1I_00855 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A1I_00855 (alr)
Enzymes [BR:rbo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A1I_00855 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:rbo01011]
 Precursor biosynthesis
  Racemase
   A1I_00855 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(156805..158037)
Genome map
AA seq 410 aa AA seqDB search
MSLCTLEINLSAIKANYRLLKNICENSVDFLHNVANKEEFAGNTSPRTAAYTLVREDASL
GSTPKLPLGASYAKNLLVGAAVKANSYGLGAIEISKTLLEENCRYFFVASSNEGISLRKA
IGDEVNILILNGVFEHDALELIEYNLIPVLNNLNQIKIWQKFSNLKNQLLPCYLHFNTGI
NRLGLNHNEIEQLINNRDLLKGLNVEYIISHLSASEDSDNPYNLEQLNKFKAYLEYFPNA
KASLANSGGIFLGKDYHFNLVRPGAALYGLNPLGSNKPNPMQNPVTLKAPIIHLQNLTYG
SRIGYNMTFTTKRDSLIATLPFGYADGFSRNFSNQGTVFINSRNVPIIGRISMDLVNIDV
TDLPPSDIFLGQEVEIIGNNCTPDKIADIIGTIGYEILTSLGNRYKRIYT
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagtttatgcactcttgaaataaatttgtcagctataaaagctaattatcgtttgttg
aaaaatatttgtgaaaactcggtagattttttgcataacgtagctaataaagaggaattt
gcaggaaacacttcacctcgcaccgcagcgtacactttagtacgtgaggatgcgagtcta
ggctcgacgcccaaattacctttaggagcaagttatgcaaaaaatctattagtaggggcg
gcagttaaagccaactcttatggactcggtgcaatagaaatttctaaaaccttgctagaa
gaaaattgccgatatttctttgttgcttcaagtaatgagggaattagtttgcgtaaagct
ataggtgatgaagtaaatattcttattcttaacggcgtatttgaacatgatgctttagaa
cttatagaatataatttaatacctgttttaaataatttaaaccaaattaagatttggcaa
aaatttagtaatctaaaaaatcaattactaccttgctacctgcattttaatactggcatt
aatcgccttgggctaaaccataatgagatagaacagctaattaataatcgtgatttgtta
aaagggttgaatgtggaatatatcataagccacttatcagcttctgaggatagcgataac
ccttataatttagaacaactaaacaaatttaaagcttatttagaatatttcccaaatgct
aaagcaagtcttgctaactccggcggtatatttttagggaaagattatcattttaattta
gtaagacctggtgctgctttatatggtttaaatcctttaggcagtaacaaaccgaatccg
atgcaaaaccctgtaaccttaaaagcacctataattcacttacaaaatttgacatatggg
agtcgtatcggctataatatgacttttacaaccaagcgtgatagcttaattgcaactctg
ccttttggctatgctgatgggtttagtcgtaattttagtaatcaaggtaccgtatttatt
aatagtcgcaacgtcccaataataggacgaatatcaatggatttagtcaatattgatgtt
accgatctaccaccctcagatatttttctaggacaagaagtagaaattattggaaataat
tgcactcctgataaaatagcagatattataggtactataggatatgagatattaactagc
cttggtaatagatataagagaatttatacttga

DBGET integrated database retrieval system