KEGG   Rickettsia bellii OSU 85-389: A1I_00870Help
Entry
A1I_00870         CDS       T00602                                 

Definition
(GenBank) 3-deoxy-D-manno-octulosonic-acid transferase
  KO
K02527  3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00540  Lipopolysaccharide biosynthesis
rbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    A1I_00870
Enzymes [BR:rbo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.12  lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     A1I_00870
    2.4.99.13  (Kdo)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     A1I_00870
    2.4.99.14  (Kdo)2-lipid IVA (2-8) 3-deoxy-D-manno-octulosonic acid transferase
     A1I_00870
    2.4.99.15  (Kdo)3-lipid IVA (2-4) 3-deoxy-D-manno-octulosonic acid transferase
     A1I_00870
Glycosyltransferases [BR:rbo01003]
 Polysaccharide
  Bacterial polysaccharide
   A1I_00870
Lipopolysaccharide biosynthesis proteins [BR:rbo01005]
 Core region
  A1I_00870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_N
Motif
Other DBs
NCBI-ProteinID: ABV78574
Position
complement(160143..161399)
Genome map
AA seq 418 aa AA seqDB search
MMRLYYFLSFLLLPIYFVIIFIRLLIGKEDIRRVKERFAIGKHRQDNRFLIWIHAASVGE
SMIALNLVDNISKHFPEVRFLVTSWTQSSAKILSTKLPKIATHQLLPIDNIIFTKIFLNN
WKPDLGIFIESELWPGTINEAAKQCKLLLVNARMSDKSFESWKKRKGFFQLIVKNFSEVI
VQSERDLQKFNELGISNTTNLGNIKFANEKLPVNQEELIKLSEHLKNKQVILFASTHPED
EEIILPIIKNLKKQVIDCYIILIPRHPERIKSILDNCIAQDLSATAKSQNDLPVLTDDLY
IVDRFGEMGLFFSIASISFIGGSFKQGGHNILEAAHFSNCIIFGPDMSKNTDIAKGVLQS
KAAIQIKSGEELLNMLEYLLDPNNSRELKNYQENSLKFVERNQKILDEYLQIITKFFP
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtttatattactttttaagttttttgttattacctatttattttgttataatt
ttcattcgcctattaataggcaaagaagatataaggcgtgttaaggagcgttttgctatc
ggtaaacacagacaagataatagatttttaatttggattcatgcggctagcgtcggcgaa
tctatgattgctttaaatttagttgataatataagcaaacattttcctgaagtccgtttt
ttagtcacttcttggacacaatcttctgctaaaatattaagcactaaattacctaaaata
gctactcaccaattgcttccgatagataatattatttttaccaaaatttttctaaataat
tggaagcctgatttaggtatttttatagaatcagaattatggccaggtactattaatgaa
gcagcaaagcagtgtaaattattgcttgtgaatgcccgcatgtctgataaatcctttgaa
tcttggaagaaaagaaaaggcttttttcagctcattgttaaaaattttagcgaagttatt
gtgcaaagtgagcgtgatttacagaaatttaatgagcttggaatatcaaacacaactaat
ttaggaaatatcaaatttgctaatgaaaagcttccagttaatcaagaagaacttataaag
ctaagtgaacatctaaaaaacaagcaagttatcctatttgctagcactcatccggaagat
gaggaaattattttacctattataaaaaacttgaaaaaacaagttatagattgctatatt
atcttaattcctaggcatcctgagcgtattaaatcaattctagataactgcatagcacaa
gatttatcagctactgctaaatcacagaatgacttacctgttttaaccgatgatctttat
atagttgataggttcggtgaaatggggttatttttctctatagcatcaatttcatttatt
ggcggctctttcaaacaaggcgggcataatattttagaggcggcacatttctctaattgt
attatctttggtcctgatatgagtaaaaacactgatattgctaaaggcgtgttgcaaagt
aaagcagctattcaaatcaaaagcggtgaagagttattaaatatgctggaatatttgctt
gatcctaataattctagagaattaaaaaactatcaagaaaattcactaaaatttgttgaa
agaaaccagaaaatacttgatgaatatcttcaaataattacaaaatttttcccataa

DBGET integrated database retrieval system