KEGG   Rickettsia bellii OSU 85-389: A1I_00880Help
Entry
A1I_00880         CDS       T00602                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K00812  
aspartate aminotransferase [EC:2.6.1.1]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Cysteine and methionine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A1I_00880
   00270 Cysteine and methionine metabolism
    A1I_00880
   00220 Arginine biosynthesis
    A1I_00880
   00330 Arginine and proline metabolism
    A1I_00880
   00350 Tyrosine metabolism
    A1I_00880
   00360 Phenylalanine metabolism
    A1I_00880
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A1I_00880
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    A1I_00880
Enzymes [BR:rbo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     A1I_00880
Amino acid related enzymes [BR:rbo01007]
 Aminotransferase (transaminase)
  Class I
   A1I_00880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(162214..163413)
Genome map
AA seq 399 aa AA seqDB search
MSIISTRLNAIKPSPTLAVVRKTLELKRAGIDIIALGAGEPDFDTPDNIKEAAIKAIKDG
FTKYTNVEGIPALKEAIQAKFKRENNIDYDLEEIIVSTGGKQVIYNLFMASLNKGDEVII
PAPYWVSYPDMVLLAEGTPVFTNCGIESNFKLSGEALEQLITPKTKWLIINSPSNPTGAS
YSHSELKNIAEVLRKHPYVNVMSDDIYEHITFDGFKFYTLAEIAPDLKDRIFTVNGVSKA
YSMTGWRIGYGAGSKALIKAMTIIQSQSTSNPCSISQVAAVEALNGVQGYIAQNALNFEK
KRDLALSILQRVKYFECYKPEGAFYLFIKCDKIFGAKTKSGKVINNSNDFGEYLLEEAKV
AVVPGIAFGLEGYFRISYATSMEELEEACLRMERACGSL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattatttctacgcgattaaatgctataaaaccatctccgacgcttgcagtagtt
aggaaaacgctcgagcttaaaagagcgggtattgatattattgcacttggggcaggtgag
cctgattttgatacgcctgataatatcaaagaagcagccatcaaagccattaaagatggg
tttactaaatatacaaacgttgaggggataccagctttaaaagaagcaatacaagctaaa
tttaaacgagaaaataatatagattatgatcttgaggaaataatagttagcaccggcggc
aagcaagttatatataatttatttatggcatctttaaataaaggggatgaggttattatt
cctgctccttattgggtgtcctatcccgatatggttttacttgctgaaggtactccggtt
tttacaaattgcggtattgaaagtaactttaaactaagcggtgaggctttagagcagtta
attacgcctaaaactaaatggcttattattaattcacctagtaatccaacaggtgcaagc
tatagccattcagagttaaaaaatattgctgaagttctaagaaagcatccgtatgtaaac
gtcatgtctgatgatatttatgagcatattacttttgatggttttaaattttatacttta
gcagaaatagcacctgatttaaaagatcggatatttactgttaatggcgtatccaaagca
tattctatgacaggttggcgtataggttatggtgcaggttcgaaagctttaattaaagct
atgactattattcagtcacaaagtacttcaaacccgtgttcaataagccaagtagcagcc
gttgaggcactaaatggcgtgcaaggctatattgcacaaaatgctttaaattttgagaaa
aaacgtgatcttgctttatcgattctacaaagagtgaaatattttgaatgctataaacct
gagggggctttttacttatttattaaatgtgataagatttttggagctaaaactaaatca
ggaaaagtaattaataatagtaatgatttcggtgaatatttacttgaagaagcaaaagtc
gctgtagtccctggtattgcttttggcttagaaggatatttcaggatttcctatgctact
tctatggaagagctggaagaggcttgtttgcgtatggagcgggcttgtggttcattatag

DBGET integrated database retrieval system