KEGG   Rickettsia bellii OSU 85-389: A1I_00915Help
Entry
A1I_00915         CDS       T00602                                 

Definition
(GenBank) bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase
  KO
K02493  
release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
Enzymes [BR:rbo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     A1I_00915
Translation factors [BR:rbo03012]
 Eukaryotic Type
  Release factors
   A1I_00915
 Prokaryotic Type
   A1I_00915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(167496..169187)
Genome map
AA seq 563 aa AA seqDB search
MQYSIQKFLNEGAYKLQHIGINNPKLEARILLQHAINKPYEYLLANPEKQLNQLEIEAVE
KVLERRLKHKPIAYILGTKEFYSREFIVNKHVLIPRNDTEILIDVVLQYHSQHFQYHSQH
SLCHSSNGGNPDKKQLDSVVKPRNNIKSSNILELGTGSGCISISLLLELPNSQITATDIS
IDAIEVAKSNAIKHDVTDRLQIIHSNWFENIGKQKFDLIVSNPPYISINEKPEMAIETIN
YEPSIALFAEEDGLLSYKIIAENAKKFLKQNGKIILEIGYKQADQVSQIFLDHGYVIDNI
HQDLQSHNRVIEISLIQLNRSYARRIGKSLSGIQQNLLDNELPKYLFSKEKLIGKNYNSC
KIKSNYTKFNLEKSKESVSRGAERIKIREHLRTYKEDVANFSSSTSIFLEIGFGMGEHFI
NQAKMNPDKLFIGVEVYLNGVANVLKLAEEQNITNFLLFPNNLDFILHDLPNNSLDRIYI
LFPDPWIKNRQKKKRILNKERLTILQTKLKNKGSLIFTSDIENYFEEVVELIKQNGNFQI
TNEDNYSKPHDNYIITKIPPKSY
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgcaatattctatacaaaagtttcttaacgaaggagcttataaattacaacacattggg
attaataatccaaaattagaagcacgaattttattgcagcatgctataaataaaccttat
gaatatctgcttgctaatcctgaaaaacaactaaaccagctagaaatagaagctgttgaa
aaagtattagaaagaagactaaagcacaaaccgatagcctatattttagggacaaaagaa
ttctactcacgtgagtttatcgttaataaacacgtattaattccaagaaacgatacggaa
attttgatagatgttgtacttcaatatcattctcaacacttccaatatcattcccagcac
tctctatgtcattccagcaacggcgggaatccagacaaaaagcaactggattccgtggtc
aagccacggaataacattaagagtagtaacatcctagagctcggcacgggtagcggttgc
atctctatcagtctattactcgaactaccgaatagtcaaataaccgcaactgatataagt
attgatgcgatagaggttgcaaaaagtaatgccataaagcatgatgtaacggatcgtttg
caaattattcatagcaattggtttgagaatattggaaaacaaaaatttgatcttatagtt
agtaacccgccatatatatctataaatgaaaagcctgaaatggcaattgagacaataaat
tatgagccatctattgctttatttgccgaagaagacggcttgctgagctataaaatcata
gcagagaatgctaaaaaatttctaaagcaaaatggtaaaattatattagaaataggatat
aaacaagcagatcaagttagccaaatctttttagatcatggttatgttattgataatatc
catcaagatttgcaatctcataatagagtaatagaaatatctttaattcagctaaatcgc
tcatatgcaagacgcatcgggaagagcctgtcaggaatacaacaaaatttattagataac
gaactaccgaaatatttattttcaaaagaaaagcttattggtaaaaattataactcctgt
aaaattaaaagtaattatacgaagttcaacttggaaaagagcaaggagtctgtaagccga
ggagcggagcgtataaaaatacgtgagcatcttaggacttacaaagaggacgtagccaat
ttttcaagttcaacgagtatatttttagagattggcttcggtatgggtgagcatttcatc
aatcaagctaagatgaatccggataaactttttatcggtgtggaggtatatctaaacggc
gttgcaaatgttttaaaacttgcagaagagcaaaacattacaaactttttattatttccc
aataatttagattttatattacatgatttaccaaataatagcttagacaggatttatatt
ttatttcctgatccttggataaaaaataggcagaaaaagaaacgtattttgaataaagaa
cgcttaacgattctacagactaagctgaaaaataaaggtagcttgatctttacttctgat
attgaaaattattttgaggaagtagtagagctaattaaacaaaatggtaatttccaaatt
actaatgaggataattattcaaaaccacacgataattatataataacgaaaataccacca
aaaagctattaa

DBGET integrated database retrieval system