KEGG   Rickettsia bellii OSU 85-389: A1I_00935Help
Entry
A1I_00935         CDS       T00602                                 

Definition
(GenBank) Uracil-DNA glycosylase
  KO
K21929  
uracil-DNA glycosylase [EC:3.2.2.27]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    A1I_00935
Enzymes [BR:rbo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     A1I_00935
DNA repair and recombination proteins [BR:rbo03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     A1I_00935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
170866..171657
Genome map
AA seq 263 aa AA seqDB search
MNNNTFKWLNAIGVEYYCSEHPPKLKVSDNTKLAEKPQAKPTPQKENGFNMNDKTHDNIS
LARSLADKANNIAELKESLLNFNGCDLKKLATNTVFGDGNPAAKIMLIGEAPGSNEDLKG
IPFCGESGNLLDNMLRAIGISRKDNAYITNTVFWRPPANRQPTLEEVDVCRPFVEKHIAL
VNPKLIILVGSTAATSLLGKNAGITKIRQEYYFYTNKYLAAPIQTTAMFHPAYLLRQPSQ
KRTSWYDLLKIKDYLESKNLVTG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaataataatacatttaaatggctaaatgcaattggggttgaatattattgctcagag
catccgccaaaattaaaagtaagcgataataccaaattggctgaaaagccacaagcaaaa
cctacgcctcaaaaagaaaacgggtttaatatgaacgataaaacacatgataatataagc
cttgcaagatcacttgccgataaagccaataatatagcagaactaaaagaatctctacta
aattttaatggctgtgaccttaagaagcttgctactaacactgtatttggtgacggtaat
ccggcagctaaaattatgttaataggtgaagctcctggcagtaatgaggatttaaaaggt
atacccttttgcggtgaaagtggtaatttacttgataatatgctgcgtgcaattgggatt
tcacgaaaagataatgcttatattaccaatacagtgttttggcgtccacctgccaatagg
cagccaactttagaggaagttgatgtttgtagaccttttgttgagaaacatattgcttta
gttaacccaaaactcattattttagttggtagcactgctgcaactagtctacttggaaaa
aatgccggtattactaaaattagacaagaatattatttttacaccaataaatatctagcc
gctcctatccagactacggcaatgttccaccctgcatatttactccgccaacctagccaa
aaacgcacctcttggtatgatttgctgaagatcaaagattatcttgaaagtaagaatttg
gtaactggttaa

DBGET integrated database retrieval system