KEGG   Rickettsia bellii OSU 85-389: A1I_00985Help
Entry
A1I_00985         CDS       T00602                                 

Definition
(GenBank) O-sialoglycoprotein endopeptidase
  KO
K01409  
N6-L-threonylcarbamoyladenine synthase [EC:2.3.1.234]
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
Enzymes [BR:rbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.234  N6-L-threonylcarbamoyladenine synthase
     A1I_00985
Transfer RNA biogenesis [BR:rbo03016]
 Eukaryotic Type
  tRNA modification factors
   KEOPS/EKC complex
    A1I_00985
 Prokaryotic Type
    A1I_00985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(190318..191343)
Genome map
AA seq 341 aa AA seqDB search
MKKILGIESSCDDTSVSIITEDREILSNIVISQNTEHADYKGVVPEIAARSHLANLEKAM
KQALLESNTSLDEITAIAATSGPGLIGGVIVGSMFAKSLSSVLNKPFIAVNHLEGHALTA
RLTDNIPYPYLLLLASGGHCQFVAVLGLGKYKILGSTIDDAVGEAFDKVAKMLDLPFPGG
PKIEKRAKLGDPYKYKFPKPIINSGDCNMSFSGLKTAVRTLIMSLQEINDTIINDIAASF
QFTIGEILSSKILEAIKVYEQITNDFNRNIVIAGGVAANKYLQELLSNCTKIHGYQLIYP
PTTLCTDNAAMIAYAGLERYNNGLFTPLNFCPKARWSLEEI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattttaggaattgaatcaagttgtgatgatactagtgtttctataataact
gaagatagggaaatcttatcgaatatagtcatatcacaaaatacagaacatgcagattat
aagggagtagtgccggaaatagccgcacgttctcatttagctaatctcgaaaaagctatg
aagcaggctttacttgagagcaatactagcttagatgaaattacggcaatagctgcaact
tcaggacctggtttaattggcggcgttatagttggctcaatgtttgcaaagtctctttct
agcgttttaaataagccttttattgcagtaaatcatttagaaggacacgcattaactgca
agattaaccgataacatcccatatccatatttgcttttgctagcttccggtgggcattgt
caatttgttgcagtacttgggcttggaaaatacaaaattcttggtagtactatagacgat
gcagtaggtgaggcttttgataaagtggctaagatgcttgacttgcctttcccaggtggt
cctaaaatcgaaaaaagggcaaagctgggcgatccttataaatataaattcccaaaacca
attattaatagtggtgattgtaatatgtctttttcagggcttaaaacagcagtgcgtact
ctaataatgagtttacaagagattaacgatactataattaacgatatagcagcaagtttt
cagtttacgataggggaaattttaagcagcaaaatactagaagctattaaagtttatgaa
caaataacaaatgattttaatagaaatatagtaatagccggcggggtggctgctaataaa
tatttgcaagaattgttaagtaattgtaccaaaatacatggctatcagcttatttacccg
cccacaacgctatgtaccgataatgctgcgatgattgcttatgccgggcttgagcgttat
aataatgggttatttacgcctttaaatttctgtcctaaagctagatggagcttagaagaa
atataa

DBGET integrated database retrieval system