KEGG   Rickettsia bellii OSU 85-389: A1I_00990Help
Entry
A1I_00990         CDS       T00602                                 

Definition
(GenBank) hypothetical protein
Organism
rbo  Rickettsia bellii OSU 85-389
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(191340..191657)
Genome map
AA seq 105 aa AA seqDB search
MILLLDELQKLATLSFADNPHVLHIRCGYQLQDALLFLKLIFVVLILFIYISIMKKSIKS
NKYSNAEKETLYLLKSPKNAKRLKRAINDFEANKNFKTTSLQKLK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
ttgattttactacttgatgaacttcaaaaattggctacgttgtcttttgctgataatcct
cacgtactacatatacgctgcggttatcagctgcaagacgccttgctctttttgaagttg
atcttcgtagtacttattttatttatatatattagcatcatgaaaaaatccataaaatca
aataaatattctaatgctgaaaaagaaactttatatttattaaaaagccctaaaaatgct
aagagattaaagcgagcaattaatgattttgaagcaaataaaaactttaaaacgacttct
ttacaaaaactcaaatga

DBGET integrated database retrieval system