KEGG   Rickettsia bellii OSU 85-389: A1I_01055Help
Entry
A1I_01055         CDS       T00602                                 

Definition
(GenBank) hypothetical protein
Organism
rbo  Rickettsia bellii OSU 85-389
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
204784..206685
Genome map
AA seq 633 aa AA seqDB search
MLKEIGFKDYLRITQNLNAPELALEFANLAITRIANKKNHLLKCLLENYPYEKLKNHKLF
IDYEISEDGSYLEHKFSKSVIFFEYKSFSNSSCLQDKIFNNFLAKKSSFYLAAIEQNIQL
MEAVFVDIFKTGHIVLNLLNTIDQEKYKTAFHFIIEIVHFVKPEFQFDIIKQLVDTIAED
FNVLATLTNVLLELEKDEEIITLLEPKLLNIKNNVIPEEDGIIFCRFNLSLAEKQLLHFL
KTEPDDKDALYNLFNIYLTQQKLDKAKDLTKNSPKDLKILMEMSLDLAEISTIKLNSINQ
DELPATSKSQFRCFEYIAKFNSYNDSERDSNYENLKEELIEIDKVIDYAVLSFTTAIYTK
QYELAAQFAKKIPKNIITPYIEKTRFLLTPVEYISEVHIEELRSKFDLSQEDAIDLVIQV
SSCLVADEQYKLALEKIEEILLLEPQNYSAIEIGLSAAELINNQEKIQEYSVLLHEKYEK
DFINDIQNTHKYYRSIKELNLRHAINNTNSNVSKWIIKEGEINKNDAISLGKYKGLDCYG
RISTDIKCDSTQYNEFINALEKGIIYKQQGNNGVKFLKENAVEIKINGGNRLYTNILNTN
PQGELLINFDHFGNHKDVIKFAGEHSLEFHEAF
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagaaattggttttaaagattatttgagaataacccaaaacttaaatgctcca
gaattagctttagaatttgctaatttagctattacaagaatagctaataaaaaaaatcat
cttctaaaatgtttattagaaaattacccttatgaaaaacttaaaaaccataaattgttt
atagattatgaaattagtgaagatggctcatatttagaacataaattttctaaatcagtt
atattttttgaatataaatctttttctaattcttcttgcttacaagataaaatttttaac
aactttcttgctaaaaaaagcagtttttatttagccgctatagaacaaaatattcaatta
atggaagcagtatttgtagatatattcaagacggggcatatagttttaaatttattaaat
actatagatcaagagaaatataaaacagcgtttcattttattatagaaattgtacatttt
gtaaaacctgaatttcaatttgatattattaaacaattagtcgatacaatagcagaagat
tttaatgttctagccactcttactaacgtattgcttgagcttgaaaaagatgaagagata
ataacattacttgaacctaaattattaaatataaaaaataatgtgataccggaagaggat
ggcattattttttgccgttttaatttatcattagctgaaaaacaacttttacatttttta
aaaaccgaacctgacgataaagatgctctctataacttatttaatatttatttaacacaa
caaaaattagacaaggctaaggatttaacaaaaaattccccaaaagatttaaaaatttta
atggagatgagtttagatttagctgagattagcactataaaactaaattcaattaatcag
gatgaattacctgcgacaagcaaaagtcaatttcgttgttttgaatatattgctaaattt
aacagctataatgattctgaaagagactcaaattatgaaaacttgaaagaagaattaatt
gagattgataaggttattgattacgcagtattatcgtttacaactgctatttataccaaa
caatatgaactagcagcacaatttgccaaaaaaatacctaaaaatataataactccatat
atagaaaaaactaggtttttattaactcctgtcgaatatataagcgaagttcatatagaa
gaactaagaagtaagtttgatttatcacaagaagatgctatagatttagtgattcaggtc
agtagctgtttagtcgcagatgaacaatataaattagccttagaaaaaattgaagaaata
ttactgcttgaacctcaaaactatagtgctatagagattggtcttagtgctgctgaatta
atcaacaatcaagaaaaaatccaagaatatagtgtattattacatgaaaaatatgaaaaa
gacttcattaatgatatacaaaatactcataaatattatcgatcaataaaagagcttaat
ttacgtcatgctatcaataatacaaatagtaatgttagtaagtggataattaaagaagga
gagattaataaaaacgatgctatttctttgggtaaatataaaggacttgattgttatgga
agaattagcacagatataaaatgtgatagtactcaatataatgaatttatcaatgcgtta
gaaaaaggcataatttacaaacagcagggaaataatggagttaaatttctcaaggaaaat
gctgttgaaatcaaaattaatggcggtaatcgtttatatacaaatatattaaatactaat
ccccaaggtgagttattaataaattttgatcattttggtaatcataaagatgtaataaaa
tttgctggagagcatagtttagaatttcatgaagctttttaa

DBGET integrated database retrieval system