KEGG   Rickettsia bellii OSU 85-389: A1I_01065Help
Entry
A1I_01065         CDS       T00602                                 

Definition
(GenBank) RDD family protein
Organism
rbo  Rickettsia bellii OSU 85-389
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(207317..207811)
Genome map
AA seq 164 aa AA seqDB search
MKKQIIYPDFIARIFSTALDLSLFAFIAIPILQFCFFYLMVFFYRDYFQSYNIDLHNQSE
VLKSVMSQEFYEYLKAGNFNKYILFNVSILLINLTVIGSYFIGFWYYKGATIGKIFMRMK
IVDANDFNRPTLKQLIKRFLGYMTFPIGIFFILFSSQNKHYMIK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaattatatacccagattttatagcacgtattttttctacggcacttgat
ttatctttatttgcttttatagcaatcccaattttacaattttgtttcttttatctaatg
gtttttttctaccgtgattatttccagagctataatattgacttgcataatcaaagcgag
gtgcttaaatctgttatgagtcaagaattttatgaatatcttaaagcaggaaattttaat
aaatatattctatttaacgtttcaattttactaattaatttaacagtgataggttcctat
tttataggtttttggtattataaaggagcaaccattggcaaaatatttatgcgtatgaaa
atagtagatgcaaacgactttaaccgtccgacccttaaacagttaattaaacgattcctt
ggatatatgacatttccgatcggtattttctttatacttttctcttctcaaaacaagcat
tacatgataaaatag

DBGET integrated database retrieval system