KEGG   Rickettsia bellii OSU 85-389: A1I_01085Help
Entry
A1I_01085         CDS       T00602                                 

Definition
(GenBank) Acylamino-acid-releasing enzyme
Organism
rbo  Rickettsia bellii OSU 85-389
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
209892..211928
Genome map
AA seq 678 aa AA seqDB search
MNKLFYIIGTILIIGVFFMFQSKSTITGDDNQIIPRKVLFGNPDKARVSLTHDGKYILYI
APKDGVLNIWLAPSDDISKAEAITHDKGRGIWSYAKAYNNKNILYTQDFNGDENDRIYSY
NIETKETKLLTPEKGVKAGLVGLSYKKPNEILIDSNERNPEYFDIYKLNLDTLEKELIYQ
NDKFTNFVTDENLNLRFGSLLDKDGAVEYYELKDGKPQLFTKISMEDSFNTAILGFDASG
ETLYMLEGRDRNTSALKAINLATNSSEILAEDSKADIGLFAVHPTKQTPQAVSINYDMVS
YKILDKDIEDDIKYLQNLDRGDLIINSRTLDDKTWIIAYNSDNSPVKYYKYDRTNKKAEF
LFTNRKELEQYKLAKMIPVIIKSRDGFDLVSYITFPNDVKLDENNIPDKKVPLIINVHGG
PWARDSWGYDPEHQWLANRGYAVLSINYRGSTGFGKDFLNAGNLEYAGKMHTDLIDGVNW
AIKNNIAEADKIGIMGGSYGGYATLVGLTMTPDVFACGVDVVGMSNLLTHVQTKAPYLTP
LLSIYKTRIGPWDTEEEKEFLRQRSPINFVDNIKKPLFIAQGAHDVRVVQAESDQIVNAM
KAKHIPVVYALYKDEGHGFAKPGNRISYYALAEQFLAKILKGRAEEIGDDLKNANLILND
QENLNGAEAEKIIDKAVG
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattattctatattataggcactatattaataataggtgtcttttttatgttt
caaagtaaatctacaataacaggtgatgataaccaaataatccctcgtaaagttctgttc
ggtaatcctgacaaggcaagagtgtcattaacccatgacggtaaatatatcttatatatt
gcaccaaaagatggcgtgctaaatatttggttagccccaagtgatgatattagtaaggca
gaggcgataacgcatgataaagggcgtggtatatggtcttatgctaaagcttataacaat
aaaaatattttatacactcaagattttaacggtgatgaaaatgaccgaatttatagttat
aatatagaaacaaaagagacaaagttacttactccggaaaagggagtaaaggctgggcta
gttggactaagctacaaaaagccgaatgaaatattaatagattcaaatgagcgtaatcct
gaatattttgatatttataaattaaatctagatactttagaaaaagaactaatttatcaa
aatgataaatttaccaattttgtaacagatgaaaatttaaatttaagatttggtagttta
ttagataaagatggtgctgttgaatattacgaattaaaagatggcaagcctcagctattt
accaaaatatcaatggaagattcgtttaataccgctatacttggttttgatgctagtggt
gaaactttatatatgctagaggggcgtgatcgtaatacctcagcccttaaagctataaat
ttagctactaatagttcagaaatattagcagaagattcaaaagctgatattggtttattt
gccgtgcatcctactaagcagaccccgcaagcagtatcaataaattacgatatggtatcg
tacaaaatattagataaagatattgaagatgatatcaaatatttacaaaaccttgatcgt
ggtgatttaattattaatagtagaacgcttgatgataaaacttggattatagcttataat
agcgataattcaccggtgaaatattataaatatgatcgcactaataaaaaagctgagttt
ttattcactaaccgtaaagaattagagcaatataaacttgctaaaatgataccggtaatt
attaagtcacgtgatggttttgatttggttagttatattactttcccaaatgatgtgaaa
cttgatgaaaataatattcctgataaaaaagttccgctaataattaatgttcacggtggt
ccatgggcacgtgatagttgggggtacgatccggagcatcaatggcttgctaatcgtggc
tatgcagttttaagtattaattatcgtggttctactggctttggtaaagatttccttaat
gctggaaatttagaatatgccggtaaaatgcatactgatttaattgatggtgtaaattgg
gcaattaagaataatatagcagaagctgataaaatagggattatgggtggaagttacggc
ggttatgcaacgctagttggtcttactatgacacctgatgtgtttgcctgcggagttgat
gttgttggtatgtctaatttattaactcatgtgcaaactaaagctccatatttgactcca
ttattaagtatatataaaacacgtataggtccttgggatactgaagaggaaaaagagttt
ttaagacaaagatcaccgattaattttgttgataatatcaaaaagcctttattcatagcc
caaggagctcatgatgtgagagtcgtgcaagcagaatccgatcaaatcgtaaatgctatg
aaagcaaagcacataccagtagtttatgcactctataaagatgaaggtcacggctttgca
aaacctggtaacagaatctcttattacgctcttgccgaacaatttttagctaaaatctta
aaaggacgtgccgaagaaattggcgatgatctaaaaaatgctaatttaattttgaacgac
caagagaatttaaatggagcagaagcagagaagataatagataaggcagttgggtag

DBGET integrated database retrieval system