KEGG   Rickettsia bellii OSU 85-389: A1I_01090Help
Entry
A1I_01090         CDS       T00602                                 

Definition
(GenBank) hypothetical protein
  KO
K12262  
cytochrome b561
Organism
rbo  Rickettsia bellii OSU 85-389
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
212058..212261
Genome map
AA seq 67 aa AA seqDB search
MLLTNTENSYGLIAKLFHWVMSIMVILMLIAGFLMDDYIEPPLKWQIFGLHEATGVLVLT
LVTLRLL
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgctacttacaaatactgaaaattcttatgggttgattgctaaacttttccactgggtt
atgagtattatggttatattaatgctcattgctggttttttaatggatgattacatagag
ccgcctttaaaatggcaaatatttggcttacatgaagcaaccggagtgctagttttaact
ttagttacattaaggcttttatga

DBGET integrated database retrieval system