KEGG   Rickettsia bellii OSU 85-389: A1I_01095Help
Entry
A1I_01095         CDS       T00602                                 

Definition
(GenBank) Transcriptional regulator
Organism
rbo  Rickettsia bellii OSU 85-389
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
212676..212930
Genome map
AA seq 84 aa AA seqDB search
MSKSARVIVSSKGQVVIPKYIRNKLGLHSGSEVIINYKKNETLELLPIKKDIFSFFGKGK
HKAKNGPIDVDEAISIAVIENDRD
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaagtgctagagtaatagtttcttcaaaagggcaagtagttatacctaaatat
ataagaaataagcttggtttgcattcaggttctgaagtaattattaattacaagaaaaac
gaaacattagaattgcttcctataaaaaaggatatttttagtttttttggtaaaggtaaa
cacaaagctaaaaatggtccaatcgacgtagatgaagctattagtattgcggttatcgaa
aatgatagggattga

DBGET integrated database retrieval system