KEGG   Rickettsia bellii OSU 85-389: A1I_01100Help
Entry
A1I_01100         CDS       T00602                                 

Definition
(GenBank) Putative nucleic-acid-binding protein
Organism
rbo  Rickettsia bellii OSU 85-389
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
212917..213306
Genome map
AA seq 129 aa AA seqDB search
MIGIDTNILTRTFLEDDEVQAKTAQNFLKNHVNHKIFISSYAILEFAWVLKVKKFTRQEI
YGAIINLIDNSGFIIGHQDIIISAAEKYIKGKADFADYMIISEGETNSVNNFVSFDKEIV
QEIKSASYP
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgatagggattgacactaatattttaactcgtactttccttgaagatgatgaagtacag
gctaagactgctcaaaattttctgaaaaatcatgttaatcataaaatctttatttcctca
tatgcaatacttgaatttgcatgggtgttaaaagtaaaaaagtttacacgccaagaaatt
tatggtgcaattataaatcttattgataattctggttttattatcggacatcaagatata
ataatatcggcagctgaaaaatatataaaaggtaaagcagattttgctgattatatgatt
atttctgaaggagagacaaatagcgttaataactttgttagttttgataaagagatagta
caagaaattaaaagtgcatcttatccttaa

DBGET integrated database retrieval system