KEGG   Rickettsia bellii OSU 85-389: A1I_01115Help
Entry
A1I_01115         CDS       T00602                                 

Definition
(GenBank) Transposase and inactivated derivative
Organism
rbo  Rickettsia bellii OSU 85-389
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEDD_Tnp_IS110 Transposase_20 HHH_2
Motif
Other DBs
NCBI-ProteinID: ABV78619
Position
complement(215836..216795)
Genome map
AA seq 319 aa AA seqDB search
MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNKDILANSLTVVETTGG
YELELLYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKALGLYGKERADKLEVFK
PESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSCINMIDVLSNQITEITNQ
VEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKLTRRQIASLAGLAPKANDS
GKYQGYRKVGHGRAGVKPIILFLAAMSARNSKTSGLRLFYERLINNGKKKMVALTALMRK
IIVIANAKLKSLLFNLKHS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgataaaatatcacaaacatataggaattgatataggaaaatataattttgtagtagga
atagagggcataaaagatacaaaagaatatgagaatacaagttccggtatatttgaattt
attaatgataataaggatattttagcaaactctctaactgtagttgaaacaacaggcgga
tatgaactagagttattgtatagcttatgtgaaagaggttatgtagtacatagagcagat
gcaagaaaggtaaagaattttatcagatcatatggtaatagtgcaaaaacagataagtta
gatgctaaagcattaggattatatggtaaggagcgagcagataagcttgaagtatttaag
cctgaatcaaaacaaaatatacaattatttcggttagtacaaagacggaatgatttaaag
caaatgttagttgccgaaaagaatagattacaacaagcaaatacagataagtttgttaaa
aatagctgtataaatatgatagatgttttaagtaatcaaattacagagattactaatcag
gtagaagtaattatatcatcagatcagctgttaaaagcaaagcatgagatattgaaagag
ataaatggcattggtaatatagttgcttttgagttattaatattattaccggagttaggg
aagttaacaagacggcagattgcttctcttgcagggcttgctccaaaagctaatgatagt
ggtaaatatcaaggatatagaaaggtaggacatggtagagcaggagtcaagcctataata
ctattccttgctgctatgtcagcccgtaatagcaagacttccggtttaagactcttttat
gagcgactcattaacaatggtaaaaagaaaatggtcgctcttaccgctttaatgcgtaaa
attattgtcatcgctaatgctaaattaaaatctcttctttttaatttaaaacatagttga

DBGET integrated database retrieval system