KEGG   Rickettsia bellii OSU 85-389: A1I_01125Help
Entry
A1I_01125         CDS       T00602                                 

Definition
(GenBank) Acetate kinase
  KO
K00925  
acetate kinase [EC:2.7.2.1]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A1I_01125
   00640 Propanoate metabolism
    A1I_01125
  Energy metabolism
   00680 Methane metabolism
    A1I_01125
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    A1I_01125
Enzymes [BR:rbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     A1I_01125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
218557..219576
Genome map
AA seq 339 aa AA seqDB search
MKNVILIANAGSSSLKISVFEIKDKKIKDKIYNIFLEKNDTKIVFHINKKQESITEINGD
AISAMIELFESWWKNQKDLHLIATGHRIVHGGKNFNKPVLVNHKISEDLKALIPLSPLHQ
PYNLKVLDLFLQKYKAVHHIACFDTSFHFTNPPIAKAFGLPKKYYDKGIIRYGFHGLSYK
YVSSHFKEMTKKDLSEKTIIAHLGSGSSLCAIKNGISLASSMGFSVLDGVMMGTRTGSLD
PGVVLYLLDHEKMTTTEITDLLYKKSGLLGISGESSDMRTLLASNNPDAKFAVDLFVHRI
VLEIGKLAAALEGLDCLIFTAGVGENSAIIHEMISDKLL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttatcttaatagctaatgccggttcgtctagtctaaaaatttccgttttt
gaaattaaagataagaaaataaaagataaaatttacaatatttttttagaaaaaaatgat
actaaaatagtatttcatataaataaaaaacaagaatctattacagaaattaatggcgat
gctatttcagcgatgattgagctttttgaaagttggtggaagaatcagaaagacttacat
ttgattgctaccggtcatagaattgttcatggaggaaaaaatttcaataaacccgttctt
gttaatcataaaattagtgaagatttaaaagcgttgatccctttaagccctttgcatcaa
ccttataatttaaaagtattagatttatttctccaaaaatacaaagcagtccaccatata
gcttgttttgatacatcgtttcactttactaacccaccaatcgcaaaagctttcggctta
ccaaaaaaatattatgataaagggattattcgttatggcttccatggtttatcatataaa
tatgttagcagtcattttaaagaaatgaccaaaaaagatttatctgaaaaaactatcata
gctcatttaggaagcggtagtagtttatgtgcaatcaaaaatggtataagtttagctagt
tctatgggttttagcgtacttgatggagtaatgatgggaactagaacaggtagccttgac
cctggggtcgtgctatatcttttggatcatgagaaaatgactaccacagaaataactgat
ctgttatataagaaatcgggactgcttggtatatcaggcgaaagctccgacatgcgtact
ttgcttgcaagtaataatcctgatgctaagtttgcggtagatttatttgtacatcgtatt
gtgcttgaaataggtaagttagcggctgctctagaggggcttgattgcttaatctttact
gccggtgttggggagaattccgctataatacatgagatgattagcgataaacttttatga

DBGET integrated database retrieval system