KEGG   Rickettsia bellii OSU 85-389: A1I_01145Help
Entry
A1I_01145         CDS       T00602                                 

Definition
(GenBank) hypothetical protein
Organism
rbo  Rickettsia bellii OSU 85-389
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4375 DUF2334
Motif
Other DBs
NCBI-ProteinID: ABV78625
Position
220968..222416
Genome map
AA seq 482 aa AA seqDB search
MSLIANKRKEKSLVKILFYKLLLAMVIIYLIILFYNYMDKLKIPTLIKHSDFYNEDKYNR
IQGIIDYVNALRNALYNQEELDQIIPQAQQVYFVDYYLSQVENGGLTQYFSNSNFNGKQN
NIVLKGLEDIKAYKNKEIFFQACQLLNNMDASLREEYLFSGMYREEEVRQKPIIKEIHIE
LEKLTDLFFEINEKEEPILDLNFKYVEKIDNLKIIDDKLYDKEIEAIVALVPNYDERKKY
SEEQWLKNMPRYTKIARKLCSKYNLELLSINALSYGESLISEEKVKENYNNNIMFYHIST
DQGYFYIIDFGKTSVLINGEDNQPIGKINNLEINFDQSNIDINSFEIEKSTNIFKTPKWS
IQLEENWKSEISEDCYSFFNPEGYGTLQISDYTKDTSITYDDVLDLVGFSYKEKTHLEVV
KFGDFEGFQYVYVNTENTLWRKLWLKNDKILLFIIYNCDINYEDHTVETTNKMLSSLKVI
TK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttatagctaacaaaagaaaagaaaaatctttagttaaaatattattctataaa
ttgttattagctatggttataatatacttgataatactattttacaattatatggataaa
ttgaaaatacctacattaattaaacattcagatttttataacgaagataaatataatcgt
attcaaggaattatagattatgtgaatgctcttcgaaatgctttatataatcaagaagaa
ttagatcaaattattcctcaagctcaacaagtatattttgtagattattatttaagccaa
gtagaaaacggaggactcacccaatatttttctaatagtaattttaatggaaaacagaat
aatattgttttaaaaggtcttgaagatataaaagcatataaaaataaagaaatatttttt
caggcttgtcaattattaaataatatggatgcctcattaagagaagaatatttattttcc
ggtatgtatcgggaagaggaagttagacagaaaccgataataaaagaaatacatatagag
ctagaaaagttaactgatctattttttgaaataaatgaaaaagaagaacccattttagat
ttaaattttaaatatgtagaaaaaatcgataatttaaaaataatcgatgataagctatat
gacaaagaaatagaagctatcgtagccttagttccaaattatgacgaaagaaaaaaatac
tcagaggaacaatggctaaaaaatatgcctagatatacaaaaattgctcgaaaattatgt
agtaaatataacttagaattattatcaattaatgctttaagttatggagaaagtcttata
agtgaggaaaaggttaaagaaaattataataataatattatgttttatcatataagtaca
gatcaaggatatttttatataattgattttggcaaaacatctgtacttattaatggtgaa
gataatcagccaataggaaaaataaataatttagaaataaatttcgaccaaagtaatata
gatataaatagctttgaaatagaaaaaagtacaaatatattcaaaactcctaaatggtct
attcaattagaagaaaattggaaatcagaaataagcgaagattgctattcattttttaat
cccgaaggttacggaacgttacaaataagtgactatactaaagatacatctataacttat
gatgatgtattagatttagtagggtttagctataaagaaaaaacacatttagaagtagta
aaatttggtgattttgaaggttttcaatatgtttatgttaatacggaaaatactttgtgg
aggaaattatggttaaaaaacgataaaatacttttattcataatttataattgtgatatt
aactatgaggatcatacggttgaaactacaaataaaatgctatcctcgctaaaagttata
actaagtaa

DBGET integrated database retrieval system