KEGG   Rickettsia bellii OSU 85-389: A1I_01180Help
Entry
A1I_01180         CDS       T00602                                 

Definition
(GenBank) Penicillin-binding protein
  KO
K05515  
penicillin-binding protein 2 [EC:3.4.16.4]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Peptidoglycan biosynthesis
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A1I_01180
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    A1I_01180
Enzymes [BR:rbo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A1I_01180
Peptidoglycan biosynthesis and degradation proteins [BR:rbo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   A1I_01180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(226688..228472)
Genome map
AA seq 594 aa AA seqDB search
MLNKKILHNELISRRAFIIGASKLGLLSLLGMRMFYLQLIKSEEYKTLSDKNRINFVVLP
PSRGRIYDLENNILATNKPCYQLLIDRSVNNNYKDELEIVSKVLNLSEEKYNYIQQKIKK
SSRHVPLMILDQLDWQQVSLIEEQKHKLTNIFIDIGYLRSYPFSNVTSHLIGYLGQINEQ
EKQGLNVYNLSDFNIGKSGIEKYYDDKLRGEFGYKKVEVNAYGKQIREISGVSSKSGNDI
HLNIDVNLQQKIQEYLNPQGSSAIVMDTENGNVLICTSSPAFESNNFSKLSESYWQSLTN
DPYKPLINKVVQNSYPPGSVFKIITILAALEAGVKPNKTFFCSGTSVLGTNSFRCWKHTG
HGTLDMSSALKHSCNTYMYEISRIVGPDKILEVARKFGLGSKTGIDLAPESSGFVPSKEW
KKKKLKLPWSIGDTFNLAIGQGYLGVTPIQLARFITAIASTGKLYTPRIVKNDLEYHNID
INSENIKIVQESLYNAVNVAGGTAYYNRILGEDRQLAGKTGTSQVQGKANANDDLSRDSI
AWERRNHALFIGFAPYHNPRYSITVFVDHGGGGSKAAAPIARKIMSDVLDKYTR
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacaaaaaaatattacataatgagctaatctcacgccgtgcttttataattgga
gcaagtaaactagggcttttatctttacttggaatgcggatgttttatctgcaacttatc
aaaagcgaggaatataagacgttatcagataaaaaccgtattaattttgttgttctacca
cctagcagaggcagaatttacgatttggaaaataatattctagctactaataagccatgc
tatcagctattaatagatcgaagcgttaataataattataaagatgagctagaaatagtt
agtaaagttttaaacttatccgaagaaaaatataattatatccagcaaaaaattaagaaa
tctagccgtcacgtgcctttgatgatactcgatcaacttgattggcaacaagtatcttta
attgaagagcagaaacataagttaactaatatatttatcgatataggatatttaaggtcc
tatcctttctcaaatgtgacttctcacctaatcggttatcttgggcagataaatgaacaa
gaaaaacaaggattgaacgtatataatttaagtgattttaatataggtaaatctggtatc
gaaaaatattatgatgataaattgcgaggggaattcggttataaaaaagttgaagttaat
gcttatggtaaacaaataagagagatctctggtgtttccagtaaatcaggcaatgatatt
catttaaatattgatgtaaatcttcagcagaaaatacaagaatatctaaatcctcaaggt
tcttctgcaatagttatggatactgaaaacggcaatgtgttaatttgtacttcttcacct
gcgtttgaatcaaataattttagcaaattatccgaaagttattggcaaagtctaactaat
gatccttataagcctttaataaataaagtagtgcagaattcttatccacctggatctgtt
tttaaaataattaccatacttgcagcattagaagcgggcgttaagccaaacaagactttt
ttttgcagcggtacttctgtactgggtactaatagttttagatgctggaaacatactggt
cacggcactcttgatatgtcatctgctcttaagcattcctgtaatacttatatgtatgag
atctctaggatagtaggacctgacaaaattcttgaggttgctagaaaatttgggctaggc
tcaaaaaccggtattgatttagcccctgaaagttcagggttcgtaccatcaaaggaatgg
aaaaagaaaaaactaaagcttccttggtcaataggtgatacttttaatttagcaatcgga
caaggttatttaggtgttacccccatccagcttgcaagatttattacagctattgcaagt
acgggtaaattatatacaccaagaatagtgaaaaatgatctagaatatcataatattgat
attaactctgaaaatattaaaatagtgcaggaaagcttgtataatgcagtgaatgttgca
ggcggtactgcctattataataggatactcggggaagatagacaacttgccggtaaaaca
ggcacttctcaagtgcaaggaaaagcaaatgctaacgatgatcttagccgtgattctatc
gcttgggagcgacgaaatcatgctttatttataggttttgctccttatcataaccctcgc
tactccattactgtttttgtcgatcatggaggcggcggaagtaaagctgctgctcccatt
gcccgcaaaatcatgtctgacgtgctggataagtatactcgctga

DBGET integrated database retrieval system