KEGG   Rickettsia bellii OSU 85-389: A1I_01190Help
Entry
A1I_01190         CDS       T00602                                 

Gene name
gpsA
Definition
(GenBank) NAD(P)H-dependent glycerol-3-phosphate dehydrogenase
  KO
K00057  glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00564  Glycerophospholipid metabolism
rbo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    A1I_01190 (gpsA)
Enzymes [BR:rbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     A1I_01190 (gpsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_Gly3P_dh_N NAD_Gly3P_dh_C ApbA F420_oxidored TrkA_N Pyr_redox_2 PDH 3HCDH_N Pyr_redox UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ABV78634
UniProt: A8GUW7
Position
complement(229353..230297)
Genome map
AA seq 314 aa AA seqDB search
MKRFKNIAVYGGGSFGTSLAAIAARVCENVTLFLRDEEIAKEITDKKTNTKYLGNIKLPS
NLQATTNLDKIKDFELIIIAVPSYAFDEAIKLLKTHISNDNILLIATKGFARNPTELFSD
RLKTLLSNNPIAFLSGPNLAKDLAKGLPASATIASLDIDLANKISYNLSSEAFVASTIND
VITLQVAGALKNIFAIKSGIDMAKEQGENAKATLIVSALKEIAILSKALGGMKNNMDILL
EAGVVGDLVLTCYSRSSRNTKFGYEFGISKDKQKFLQEYKELVEGREAIKLVLELIERYD
LDMPIVSSLGNVIR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatttaaaaatattgcagtatatggaggagggagtttcggcacaagccttgca
gccatagcagcaagggtttgcgagaacgttaccttatttttgcgtgatgaagaaatagca
aaagaaataacagataagaaaaccaacacaaaatatttaggcaatattaaactaccgtct
aatctacaagctaccactaatctagataaaattaaggattttgagctaattattattgca
gtaccgtcttacgcttttgatgaggcaataaagttactaaaaacacatatctcaaacgat
aatattcttctaattgctacaaaaggttttgcacgtaatcctactgaattattttctgat
aggcttaaaactttattatcaaataaccctatagcatttttatctggtccgaatttagca
aaagatctagcaaaaggtttgcctgcttctgcaaccattgcaagcttagatatagattta
gcaaataaaatatcttataatctatcttcagaagctttcgttgctagtactattaatgac
gttataacattacaagtagcaggtgctttaaaaaatatttttgccattaaaagcggcatt
gatatggcaaaagagcagggcgaaaatgcaaaagcaaccctaatcgtatctgccttaaaa
gaaatagcgatattatcaaaagctttaggtggcatgaaaaataatatggatattttgcta
gaagctggcgtggttggtgatttagtgcttacttgttactcgaggagttcacgtaataca
aaatttggttatgagtttggcataagtaaagacaaacagaaatttttacaagaatataaa
gagctagtggaaggaagagaggcgataaagctcgttttggagttgatagaaagatatgat
ttggatatgcctattgtctcttctttaggtaatgtcattagatag

DBGET integrated database retrieval system