KEGG   Rickettsia bellii OSU 85-389: A1I_01210Help
Entry
A1I_01210         CDS       T00602                                 

Definition
(GenBank) hypothetical protein
Organism
rbo  Rickettsia bellii OSU 85-389
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMP_b-brl PagL OmpW BCSC_C
Motif
Other DBs
NCBI-ProteinID: ABV78638
Position
complement(234249..234998)
Genome map
AA seq 249 aa AA seqDB search
MKKLLLITAASTAILSSAAIFAATDPCEGVVMNAPMTDSAMNSSMPASAMENQWYLKLDA
GAVIFDSQKDKVTGIKVKSNTGFTGEIGAGYYIMDNLRTDFTVGLVTSNHLKKSANDKYG
DRVSVKHRPNIVSFLLNGYVDVVDLNMFKVFAGAGIGAAMVKEKISYTFPDPDIENGKVN
IKNKTNFAYQLSLGASFEVAQGVKAELVYSWRDYGKTKTKTITEGSDSTRYGGTRYRGNN
LMAGLRFDM
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattacttttaataacagctgcaagtacagctattttatcttcagctgcaata
tttgctgctactgatccttgtgaaggagttgtgatgaatgcccctatgactgattcagct
atgaattcatcaatgccggcatcagctatggaaaatcaatggtatttaaaattagatgct
ggtgctgtgatttttgatagccaaaaagataaggttacaggaataaaagtgaagtctaat
actggctttactggggaaatcggagcaggttactatattatggataatctaagaactgat
ttcacagttggtttagtaacaagtaatcatttaaaaaaatcagcgaatgataaatatggt
gatagagtttcagtaaaacatagacctaatattgtaagctttttattaaatggttatgtt
gacgtagttgatttaaatatgtttaaagtttttgctggtgctggtatcggtgctgcaatg
gtgaaagaaaaaatttcatatacattccctgatcctgatatcgaaaatggtaaggtaaat
attaaaaataaaacaaattttgcttatcagttatctttaggtgcttcatttgaagttgct
caaggtgtaaaagctgagctagtatatagctggagagattacggtaagacaaaaactaaa
actattactgaaggtagtgattcaacaagatatggtggaacacgctatagaggtaataac
ttaatggctggtctaagatttgatatgtaa

DBGET integrated database retrieval system