KEGG   Rickettsia bellii OSU 85-389: A1I_01225Help
Entry
A1I_01225         CDS       T00602                                 

Definition
(GenBank) Heme exporter protein C
  KO
K02195  
heme exporter protein C
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
ABC transporters
Module
Heme transport system
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    A1I_01225
Transporters [BR:rbo02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Heme transporter [MD:M00259] [OT]
    A1I_01225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(236324..237016)
Genome map
AA seq 230 aa AA seqDB search
MFKLLNPHYFDKLSKIVIPILTILTFLTSAIGLYLGLVVSPPDYQQGDFVRIMYVHVPAS
WMALAIYVFMAACSFSYLVWKTTMSYLLAVAASYTGATFTLISLVTGSIWGKPIWGVWWV
WDARLTSMLILFLLYLSYIIIVNSAEDIRKAQNPASIIALIGLINIPIIKFSVNLWYSLH
QPASVLRLGSPTIHSSMLKPLMIMFVSFILYFLLILFLRTSILINKIKNR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaattactaaaccctcattattttgataaattatcaaaaatagtaattcctata
ttgacaatattgacttttctaacatcggctattggtctttatttagggctagtagtttcc
ccgcctgattatcaacaaggcgatttcgtacgtattatgtatgttcatgtgcctgcctct
tggatggcactcgctatttatgtctttatggcagcctgtagcttcagctatttagtatgg
aaaactactatgtcatatttgcttgcggtagctgctagctataccggagctactttcacc
ttaattagcttagtaacaggcagtatatggggaaagcctatatggggagtatggtgggta
tgggatgcacggcttacttcaatgttaatattattcctactatatttaagctacattata
atagttaatagtgcagaagatataagaaaagcacaaaaccctgcttctattattgccctt
attggacttattaacataccaataataaaattttctgtaaatctttggtatagcctgcac
cagccagctagtgttttaagattaggatcaccaactattcactcatcaatgctaaaacct
ttaatgataatgtttgtaagttttatattatattttttgttaatattatttttaagaacc
tctatattaatcaacaaaattaaaaaccgataa

DBGET integrated database retrieval system