KEGG   Rickettsia bellii OSU 85-389: A1I_01230Help
Entry
A1I_01230         CDS       T00602                                 

Definition
(GenBank) Transposase and inactivated derivative
Organism
rbo  Rickettsia bellii OSU 85-389
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
237454..238410
Genome map
AA seq 318 aa AA seqDB search
MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNKDILANSLTVVETTGG
YELELLYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKALGLYGKERADKLEVFK
PESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSCINMIDVLSNQITEITNQ
VEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKLTRRQIASLAGLAPKANDS
GKYQGYRKVGHGRAGVKPILFLAAMSARNSKTSGLRLFYERLINNGKKKMVALTALMRKI
IVIANAKLKSLLFNLKHS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgataaaatatcacaaacatataggaattgatataggaaaatataattttgtagtagga
atagagggcataaaagatacaaaagaatatgagaatacaagttccggtatatttgaattt
attaatgataataaggatattttagcaaactctctaactgtagttgaaacaacaggcgga
tatgaactagagttattgtatagcttatgtgaaagaggttatgtagtacatagagcagat
gcaagaaaggtaaagaattttatcagatcatatggtaatagtgcaaaaacagataagtta
gatgctaaagcattaggattatatggtaaggagcgagcagataagcttgaagtatttaag
cctgaatcaaaacaaaatatacaattatttcggttagtacaaagacggaatgatttaaag
caaatgttagttgccgaaaagaatagattacaacaagcaaatacagataagtttgttaaa
aatagctgtataaatatgatagatgttttaagtaatcaaattacagagattactaatcag
gtagaagtaattatatcatcagatcagctgttaaaagcaaagcatgagatattgaaagag
ataaatggcattggtaatatagttgcttttgagttattaatattattaccggagttaggg
aagttaacaagacggcagattgcttctcttgcagggcttgctccaaaagctaatgatagt
ggtaaatatcaaggatatagaaaggtaggacatggtagagcaggagtcaagcctatacta
ttccttgctgctatgtcagcccgtaatagcaagacttctggtttaagactcttttatgag
cgactcattaacaatggtaaaaagaaaatggtcgctcttaccgctttaatgcgtaaaatt
attgtcatcgctaatgctaaattaaaatctcttctttttaatttaaaacatagttga

DBGET integrated database retrieval system