KEGG   Rickettsia bellii OSU 85-389: A1I_01305Help
Entry
A1I_01305         CDS       T00602                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
Enzymes [BR:rbo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A1I_01305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
256781..257410
Genome map
AA seq 209 aa AA seqDB search
MTYCDKSNQTSYPFVLPNLPYEKESFKPHFTAETFEYHHGKHHNAYVQNLNNLLKDKEEL
QKKNLEEIIDWSSQNQNIAIFNNAAQVWNHTFFWHSIKPNGGGKPSGKILKQINEDFGSF
EEFCEQFKAEATGQFGSGWAWLVYHNNRLQIVKTANAGTPIANGMQPLLACDVWEHAYYI
DYRNKRPDYVDIFIKHMINWEFVENNLTK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgacttattgtgataaatctaatcaaacttcctatccttttgtgctccctaatttacct
tatgaaaaagaaagttttaaaccacattttactgctgaaacttttgaatatcatcatggt
aaacatcataatgcttacgtgcagaatttaaataatttgctaaaagataaagaagaacta
caaaaaaagaatttagaagaaattatagactggtcatcgcaaaatcaaaatattgcaatt
tttaataatgctgcacaggtttggaatcatacatttttttggcattcaataaagccgaat
ggtggaggaaagccaagtggtaagatattaaagcaaattaatgaggattttggtagtttt
gaagagttttgtgaacagtttaaagcagaagcaacggggcagttcgggagtggctgggct
tggcttgtatatcataataatagattacaaattgtaaaaactgcaaatgctggtacacct
atagcaaatggtatgcaaccgcttcttgcatgtgatgtttgggagcatgcttattatatt
gattatcgtaacaaacgtcctgattacgttgacatttttattaagcatatgatcaattgg
gaatttgtagaaaataatttaactaaatga

DBGET integrated database retrieval system