KEGG   Rickettsia bellii OSU 85-389: A1I_01315Help
Entry
A1I_01315         CDS       T00602                                 

Definition
(GenBank) hypothetical protein
Organism
rbo  Rickettsia bellii OSU 85-389
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABV78655
Position
complement(259192..259521)
Genome map
AA seq 109 aa AA seqDB search
MACPRDDTLNYKLIRSLFKSPCNKIILIIDKQLLKSYLGLVRSIILGTLSYLKLIKIFIC
DEKYNADFSDILLGKVNKISGCDSTISFDIKALNLKEFDDPINILEKDK
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
gtggcttgtccacgggatgacactcttaactataagctaattcgtagtttatttaaatca
ccatgtaataaaattatacttataattgataaacaattgctaaaatcctatttgggttta
gttcgttctattattcttggtactttatcctatctcaaattaattaaaatttttatctgt
gatgaaaaatataatgctgacttttcagatattttattaggtaaagttaataaaatatct
ggatgtgattctactataagctttgatattaaagctttaaatttaaaagagtttgatgac
cctattaatatcttagaaaaagataaatag

DBGET integrated database retrieval system