KEGG   Rickettsia bellii OSU 85-389: A1I_01335Help
Entry
A1I_01335         CDS       T00602                                 

Gene name
lpxD
Definition
(GenBank) UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
  KO
K02536  
UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC:2.3.1.191]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    A1I_01335 (lpxD)
Enzymes [BR:rbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.191  UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
     A1I_01335 (lpxD)
Lipopolysaccharide biosynthesis proteins [BR:rbo01005]
 Lipid A
  A1I_01335 (lpxD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
261397..262380
Genome map
AA seq 327 aa AA seqDB search
MAIADFLQDFIEAPKIHEDVAIHDIKILQEASSNDISFLSNIKYSRFLKNTKAAACIVPK
DFTGEVNPNTVLLRAENSYFAYGKLIDFFYAPVKSYPAKIMKSAYVAESATIGKNCYVGH
NAVIEDNVVIGDDSIIEAGSFIGTGVVIGRNARIESNVSINYSVIGDDVVILSGAKIGQD
GFGFSTEKGMHHKIFHTGIVKIGNNVEIGANTTIDRGSLQDTIIEDLCRIDNLVQIGHSV
KIGKGSIIVAQAGIAGSSVIGKYCALGGQVGVAGHLYIGDGAQVAAQGGVAQNIEAGKIV
GGSPAVPIMDWHRQSIIMKQLINKRSK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgcagatttcctacaagattttatagaagctcctaaaattcatgaagatgta
gctattcatgatattaaaattttacaagaagcctcttctaatgatattagctttttaagt
aatattaaatattctcgatttttaaaaaatactaaagctgcagcttgtatcgtgccaaaa
gactttacgggagaagtaaatcccaatactgttttattgcgtgctgaaaattcatatttt
gcttacggcaagctaatagattttttctatgctccggtaaaatcgtatcctgctaaaata
atgaaatcagcttatgttgcagaatcagcaactataggtaaaaattgttatgtaggtcat
aatgcagttattgaggataatgttgttataggtgatgatagtataatagaagcaggcagc
tttataggtacaggagtggttattggcagaaatgctagaatcgaatctaatgtatcaata
aattattctgttataggggatgatgttgtaatactttcaggagcaaaaatcggacaagac
gggtttggcttttctactgaaaaaggtatgcatcataaaatatttcatactggaattgtt
aaaatcggtaataatgttgaaatcggtgctaacactactatcgataggggatcgctgcaa
gatactataatagaagatttatgccgcatagataatttagtgcagatcgggcatagcgtc
aaaataggtaaaggctctattattgtagcacaagcaggcatagccggaagtagcgtaatt
ggtaaatattgtgctcttggggggcaagtgggagtcgctggacatctatatataggtgat
ggagctcaggtagcagcacaaggcggtgtagcacaaaatatagaagcgggtaagattgtt
ggcggtagtccagctgtacctattatggattggcacagacaatctattattatgaaacaa
ttaataaataagagatctaaataa

DBGET integrated database retrieval system